Recombinant Schizosaccharomyces pombe Probable C-5 sterol desaturase 2 (pi075, SPBC27B12.03c)

Shipped with Ice Packs
In Stock

Description

Overview of the Enzyme

The recombinant Schizosaccharomyces pombe Probable C-5 Sterol Desaturase 2 (pi075, SPBC27B12.03c), also known as erg32, is a key enzyme in the ergosterol biosynthesis pathway of fission yeast. It catalyzes the dehydrogenation of episterol to ergosterol via a C-5(6) desaturation reaction, a critical step in maintaining membrane fluidity and integrity .

Key Features:

ParameterDetail
Gene Nameerg32 (synonyms: pi075, SPBC27B12.03c)
UniProt IDO13666
FunctionConverts episterol to ergosterol by introducing a C-5(6) double bond
Subcellular LocalizationEndoplasmic reticulum and vesicles

Functional Role in Sterol Biosynthesis

C-5 sterol desaturases are conserved across eukaryotes, with distinct roles in different organisms:

  • Fungi: Catalyzes the conversion of episterol to ergosterol, a membrane sterol critical for cell growth and stress adaptation .

  • Mechanism: Requires NAD(P)H as a cofactor and involves an iron-coordinated oxygen for radical-mediated hydrogen abstraction .

In S. pombe, heterologous expression of orthologs (e.g., FvC5SD) increases ergosterol levels by ~1.5-fold, altering membrane composition and enhancing tolerance to ethanol and thermal stress .

Impact on S. pombe Physiology

PhenotypeObservation
Ergosterol Content~1.5-fold increase in strains expressing C-5 desaturase
ThermotoleranceEnhanced growth at 40°C and 16°C compared to controls
Ethanol ToleranceImproved survival under high ethanol concentrations
Cell Wall SensitivityIncreased susceptibility to Congo red and calcofluor white

Metabolic Profiling

Gas chromatography-mass spectrometry (GC-MS) revealed:

  • Ergosterol: Primary sterol, increased in C-5 desaturase-expressing strains.

  • Episterol: Reduced accumulation, confirming enzyme activity .

  • Ergosta-5,7,22,24(28)-tetraene-3β-ol: Intermediary product of downstream C-22 desaturase (ERG5) .

Comparative Insights

While S. pombe erg32 is distinct from other fungal C-5 desaturases (e.g., Candida albicans ERG3), studies highlight species-specific differences in sterol diol production and azole susceptibility . These variations underscore the enzyme’s evolutionary adaptation to unique sterol biosynthesis pathways.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
erg32; pi075; SPBC27B12.03c; Delta(7-sterol 5(6-desaturase erg32; C-5 sterol desaturase erg32; Ergosterol Delta(5,6 desaturase erg32; Ergosterol biosynthesis protein 32; Sterol-C5-desaturase erg32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
erg32
Target Protein Sequence
MDVVLQYADKYVFDTFYGKIAESFDSSSSFANTAVNSTTLGLAEKVNFAITSGLLDRNNV WRQFTSLFLITWIMGTLSYFLSASFAYYVYFDREEARRHPKFLKNQEHLELMVALKNLPG MAILTAPWFLAEIRGYGYVYDKLDEYGYFYLFFSIALFLLFSDFLIYWIHRALHHRWLYA PLHKLHHKWIVPTPYSSHAFHYLDGYSQSLPYHMFPFFFPLNKYVYLLLFGSVNYWTVLI HDGKYFSNNAVVNGAAHHAAHHMYFNYNYGQFFTLFDRLCSSYRQPDQELFDAELRNEKL QEQRIRFMETVQYTVEGKDDRTYASKKDN
Uniprot No.

Target Background

Function

This recombinant Schizosaccharomyces pombe Probable C-5 sterol desaturase 2 (pi075, SPBC27B12.03c) catalyzes the introduction of a C-5 double bond into the B ring of ergosterol. This enzyme plays a crucial role in ergosterol biosynthesis, a sterol essential for plasma membrane structure and function, and for the proper localization of plasma membrane proteins.

Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the basic function of C-5 sterol desaturase in Schizosaccharomyces pombe?

C-5 sterol desaturase (erg32) in S. pombe catalyzes the dehydrogenation of a C-5(6) bond in sterol intermediates during ergosterol biosynthesis. This enzyme couples sterol oxidation to the oxidation of NAD(P)H and the reduction of molecular oxygen. The protein contains conserved histidine residues that likely coordinate an iron cation essential for catalytic activity. In S. pombe, sterols are enriched in the plasma membrane at growing cell tips and at the site of cytokinesis, indicating that proper sterol biosynthesis is critical for cell polarity and division .

How does the function of S. pombe C-5 sterol desaturase compare to homologs in other fungal species?

S. pombe C-5 sterol desaturase belongs to a family of enzymes that perform similar functions across fungal species but with notable functional differences. Compared to homologs in Candida albicans, Candida auris, Cryptococcus neoformans, Aspergillus fumigatus, and Rhizopus delemar, each enzyme exhibits distinct properties in terms of catalytic efficiency and substrate specificity. These differences are reflected in varying levels of ergosterol production when expressed in heterologous systems. For instance, when expressed in a C. albicans erg3Δ/Δ mutant, different homologs restore C-5 sterol desaturase activity to varying degrees, affecting stress responses and hyphal growth .

What is the recommended expression system for recombinant S. pombe C-5 sterol desaturase 2?

E. coli is the recommended expression system for recombinant S. pombe C-5 sterol desaturase 2. The full-length protein (1-329 amino acids) can be efficiently expressed with an N-terminal His tag for purification purposes. When designing expression constructs, it is important to consider codon optimization for E. coli to enhance protein yield. For functional studies in yeast systems, expression from a constitutive promoter such as TEF1 provides consistent levels of protein production .

What are the optimal storage conditions for purified recombinant S. pombe C-5 sterol desaturase 2?

Purified recombinant S. pombe C-5 sterol desaturase 2 should be stored in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose. For long-term storage, it is recommended to add glycerol to a final concentration of 50% and store aliquots at -20°C or -80°C. Repeated freeze-thaw cycles should be avoided to maintain protein activity. For working stocks, aliquots can be stored at 4°C for up to one week. Prior to use, vials should be briefly centrifuged to bring contents to the bottom .

What reconstitution protocols are recommended for lyophilized recombinant S. pombe C-5 sterol desaturase 2?

For reconstitution of lyophilized recombinant S. pombe C-5 sterol desaturase 2:

  • Briefly centrifuge the vial before opening to ensure all material is at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Prepare multiple small aliquots to minimize freeze-thaw cycles

  • Store reconstituted protein at -20°C or -80°C for long-term storage

The purity of properly reconstituted protein should be greater than 90% as determined by SDS-PAGE .

How can the enzymatic activity of recombinant S. pombe C-5 sterol desaturase 2 be assessed in vitro?

The enzymatic activity of recombinant S. pombe C-5 sterol desaturase 2 can be assessed by measuring its ability to convert sterol substrates lacking a C-5 double bond to products containing this modification. A comprehensive protocol involves:

  • Preparing reaction mixtures containing the purified enzyme, appropriate sterol substrate (such as episterol), and cofactors (NAD(P)H and molecular oxygen)

  • Incubating reactions under controlled temperature and pH conditions

  • Extracting sterols using organic solvents

  • Analyzing sterol conversion using gas chromatography-mass spectrometry (GC-MS)

  • Quantifying the relative abundance of substrate and product sterols

The enzyme can utilize either NADH or NADPH as a cofactor, though efficiency may vary depending on the specific experimental conditions .

What methods can be used to analyze the localization of C-5 sterol desaturase 2 in S. pombe cells?

To analyze the localization of C-5 sterol desaturase 2 in S. pombe cells, researchers can employ several complementary approaches:

  • Fluorescent protein tagging: Generating a C-5 sterol desaturase 2-GFP fusion protein expressed from its native promoter to visualize localization using fluorescence microscopy

  • Immunofluorescence microscopy: Using antibodies against the native protein or an epitope tag

  • Subcellular fractionation: Separating cellular components by differential centrifugation followed by Western blot analysis

  • Sterol-rich domain visualization: Using filipin staining to visualize sterol-rich domains and correlating with protein localization

Research has shown that in S. pombe, sterols are enriched in the plasma membrane at growing cell tips and at the site of cytokinesis, suggesting that C-5 sterol desaturase 2 activity may be spatially regulated during the cell cycle .

How can the sterol composition of S. pombe be analyzed following genetic manipulation of C-5 sterol desaturase 2?

The sterol composition of S. pombe following genetic manipulation of C-5 sterol desaturase 2 can be analyzed using the following methodology:

  • Cultivate yeast cells to mid-logarithmic phase under appropriate conditions

  • Harvest cells and disrupt cell walls using glass beads or enzymatic methods

  • Extract total sterols using chloroform:methanol (2:1) or similar solvent systems

  • Separate and identify sterol species using gas chromatography-mass spectrometry (GC-MS)

  • Quantify relative sterol abundance based on peak areas

The sterol profile of wild-type S. pombe typically shows ergosterol as the predominant sterol. Disruption of C-5 sterol desaturase 2 would result in accumulated intermediates such as ergosta-7,22-dienol and episterol [ergosta-7,24(28)-dienol] with a corresponding decrease in ergosterol levels, similar to patterns observed in other fungal species .

How does manipulation of S. pombe C-5 sterol desaturase 2 affect sensitivity to azole antifungals?

Manipulation of S. pombe C-5 sterol desaturase 2 significantly affects sensitivity to azole antifungals through several mechanisms:

  • Azole antifungals such as fluconazole inhibit sterol 14α-demethylase (S14DM), leading to depletion of ergosterol and accumulation of toxic sterol intermediates

  • In the presence of functional C-5 sterol desaturase, azole inhibition leads to the production of 14α-methylergosta-8,24(28)-dien-3β,6α-diol, a toxic sterol that disrupts membrane function

  • Loss or inhibition of C-5 sterol desaturase activity prevents formation of this toxic diol, potentially conferring azole resistance

  • Different C-5 sterol desaturase homologs vary in their propensity to produce toxic diols when S14DM is inhibited

Comparative studies with C-5 sterol desaturases from different fungal species expressed in C. albicans have shown that homologs can be classified into three categories based on diol production: high (>5% normalized diol content), intermediate (1-5%), and minimal (<1%). This heterogeneity in function has important implications for antifungal drug development and understanding resistance mechanisms .

What role does S. pombe C-5 sterol desaturase 2 play in cell membrane organization and function?

S. pombe C-5 sterol desaturase 2 plays a crucial role in cell membrane organization and function through its contribution to ergosterol biosynthesis:

  • Sterols produced through the ergosterol biosynthetic pathway are enriched in the plasma membrane at growing cell tips and at the site of cytokinesis

  • These sterol-rich membrane domains provide a structural framework for interactions among specific proteins

  • The distribution of sterols is regulated in a cell-cycle-dependent manner and requires a functional secretory pathway

  • Disruption of sterol-rich membrane domains (using sterol sequestering agents or genetic manipulation) affects multiple processes regulating cytokinesis

  • In cells with compromised sterol biosynthesis, defects in proper maintenance of the actomyosin ring and/or its attachment to the overlying plasma membrane can be observed

  • The stability of plasma membrane proteins that colocalize with sterol-rich membrane domains is compromised when sterol biosynthesis is disrupted

These findings establish S. pombe as a genetically tractable model organism for studying the role of sterol-rich membrane domains in cell polarity and cytokinesis .

How can S. pombe C-5 sterol desaturase 2 be used as a model to understand sterol biosynthesis across different species?

S. pombe C-5 sterol desaturase 2 serves as an excellent model for comparative studies of sterol biosynthesis across species due to several factors:

  • The enzyme is highly conserved among eukaryotes while exhibiting species-specific functional differences

  • S. pombe offers a genetically tractable system with well-established molecular tools

  • Heterologous expression of C-5 sterol desaturases from different species in S. pombe or other yeast systems allows direct functional comparison

To utilize this model effectively:

  • Clone C-5 sterol desaturase coding sequences from species of interest

  • Express these sequences in an S. pombe erg32 deletion mutant under control of a constitutive promoter

  • Analyze restoration of ergosterol biosynthesis through sterol profiling

  • Compare stress tolerance, growth characteristics, and response to antifungal drugs

  • Perform site-directed mutagenesis to identify critical residues for function across different homologs

This approach has successfully demonstrated functional distinctions between C-5 sterol desaturases from various fungal pathogens, revealing differences in catalytic efficiency and substrate specificity that may influence pathogenicity and drug resistance .

What are the most effective mutational analysis approaches to study S. pombe C-5 sterol desaturase 2 structure-function relationships?

To effectively study structure-function relationships in S. pombe C-5 sterol desaturase 2, several complementary mutational analysis approaches can be employed:

  • Site-directed mutagenesis of conserved histidine residues: The enzyme contains conserved histidine residues that likely coordinate an iron cation essential for catalytic activity. Systematic mutation of these residues can reveal their specific roles in the reaction mechanism.

  • Alanine-scanning mutagenesis: Systematic replacement of amino acids with alanine across specific domains to identify regions critical for substrate binding, catalysis, or protein stability.

  • Chimeric enzyme construction: Creating fusion proteins between S. pombe C-5 sterol desaturase 2 and homologs from other species to identify domains responsible for functional differences.

  • Mutation of potential membrane-interaction domains: As an integral membrane protein, identifying regions involved in membrane association and topology can provide insights into function.

  • In vivo complementation assays: Expressing mutant variants in an erg32 deletion strain and assessing restoration of phenotypes including growth, stress resistance, and sterol profiles.

Previous studies with C-5 sterol desaturases from other species have identified threonine 114 (which is a serine in humans, mice, and yeast) as potentially important for stabilizing enzyme-substrate complexes .

How can S. pombe C-5 sterol desaturase 2 be utilized in toxicity prediction assays?

S. pombe C-5 sterol desaturase 2 can be incorporated into toxicity prediction assays through several approaches:

  • Genetically modified reporter strains: Creating S. pombe strains with modifications to C-5 sterol desaturase 2 expression or activity, coupled with reporters that indicate cellular stress or membrane disruption.

  • Dose-response assessment protocol:

    • Thaw and culture S. pombe cells in liquid medium under controlled conditions to ensure exponential growth

    • Prepare cultures of wild-type and C-5 sterol desaturase 2 mutant strains

    • Expose cells to increasing concentrations of toxic substances

    • Measure optical density spectrophotometrically after exposure

    • Repeat at least three times for quantitative analysis

    • Compare responses between wild-type and mutant strains to identify toxicity mechanisms related to sterol biosynthesis

  • Specific mechanism investigation using defective mutants:

    • Select mutants with specific defects in C-5 sterol desaturase 2 or related pathways

    • Prepare and treat cultures similarly to wild type

    • Measure optical density after exposure for quantitative analysis

    • Identify differential sensitivity patterns that reveal toxicity mechanisms

This methodology ensures robust and reproducible results for investigating the effects of toxic substances on S. pombe and can specifically reveal how compounds may interfere with sterol biosynthesis pathways .

What are the current challenges in structural characterization of S. pombe C-5 sterol desaturase 2?

Structural characterization of S. pombe C-5 sterol desaturase 2 faces several significant challenges:

  • Membrane protein crystallization difficulties: As an integral membrane protein, C-5 sterol desaturase 2 is inherently difficult to crystallize due to its hydrophobic nature and requirement for detergents or lipid environments.

  • Multiple transmembrane domains: The protein contains multiple predicted transmembrane domains, complicating expression, purification, and structural studies.

  • Active site characterization: The precise arrangement of the active site, including coordination of the iron cofactor by histidine residues, remains to be fully elucidated.

  • Substrate binding mechanism: Understanding how the enzyme recognizes and positions its sterol substrate requires sophisticated structural and biochemical approaches.

  • Conformational changes during catalysis: The enzyme likely undergoes conformational changes during the catalytic cycle that are difficult to capture with static structural methods.

To address these challenges, researchers are employing a combination of approaches:

  • Cryo-electron microscopy for membrane protein structures

  • Molecular dynamics simulations to predict protein-substrate interactions

  • Hydrogen-deuterium exchange mass spectrometry to probe protein dynamics

  • Spectroscopic methods to characterize the iron center and its coordination environment

  • Homology modeling based on related proteins with known structures

How do the sterol profiles differ when various fungal C-5 sterol desaturase homologs are expressed in a model system?

When various fungal C-5 sterol desaturase homologs are expressed in a model system such as a C. albicans erg3Δ/Δ mutant, distinctive sterol profiles emerge that reflect functional differences between the enzymes. The table below summarizes sterol composition data from a comparative study:

Sterol Specieserg3Δ/ΔCaERG3CgERG3CaurERG3CnERG3RdERG3ARdERG3BAfERG3AAfERG3BAfERG3C
Ergosterol0.088.080.587.587.686.589.058.588.80.0
Other C-5 desaturated sterols0.04.54.84.34.34.34.34.44.30.0
Ergosta-7,22-dienol49.80.00.10.00.00.00.00.00.048.8
Episterol37.50.10.10.00.00.10.00.10.038.9
Total C-5 desaturated sterols0.092.585.391.891.990.893.362.993.10.0

Key observations from this data:

  • All homologs except AfERG3C restored C-5 sterol desaturase activity, though to varying degrees

  • CgERG3 and RdERG3A showed lower C-5 sterol desaturase activity compared to other functional homologs

  • AfERG3C completely lacked functional activity, similar to the erg3Δ/Δ mutant

  • The strains expressing non-functional desaturases accumulated significant levels of ergosta-7,22-dienol and episterol

These differences in sterol profiles correlate with variations in stress tolerance, growth characteristics, and response to antifungal compounds, highlighting the functional diversity among homologous enzymes .

What methodological approaches can detect differences in diol formation during azole treatment across different C-5 sterol desaturase variants?

To detect differences in diol formation during azole treatment across different C-5 sterol desaturase variants, researchers can employ the following methodological approach:

  • Strain preparation:

    • Express different C-5 sterol desaturase variants in a common genetic background (e.g., C. albicans erg3Δ/Δ)

    • Confirm comparable expression levels through RT-PCR or Western blotting

    • Verify functional activity through sterol profiling under normal conditions

  • Azole exposure protocol:

    • Grow strains to mid-logarithmic phase

    • Expose cultures to sub-inhibitory concentrations of fluconazole

    • Incubate for sufficient time to allow sterol profile alteration (typically 16-24 hours)

  • Sterol extraction and analysis:

    • Harvest cells and extract total sterols using chloroform:methanol extraction

    • Analyze sterol composition by gas chromatography-mass spectrometry

    • Quantify relative diol content (14α-methylergosta-8,24(28)-dien-3β,6α-diol)

    • Normalize diol content to total C-5 sterol desaturase activity observed in the absence of fluconazole

  • Classification of enzyme propensity for diol formation:

    • High propensity: >5% normalized diol content (e.g., CaErg3p, CaurErg3p, CnErg3p, AfErg3B)

    • Intermediate propensity: >1% but <5% normalized diol content (e.g., CgErg3p, AfErg3B, RdErg3B)

    • Low propensity: <1% normalized diol content (e.g., RdErg3A, AfErg3A)

This approach allows precise quantification of the propensity of different C-5 sterol desaturase variants to catalyze the formation of toxic diols in the presence of azole antifungals, providing insights into mechanisms of azole sensitivity and resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.