Recombinant Schizosaccharomyces pombe Probable CAAX prenyl protease 1 (SPAC3H1.05)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant SPAC3H1.05 is produced with high purity (≥85% by SDS-PAGE) and optimized for stability :

ParameterSpecification
Purity≥85% (verified by SDS-PAGE)
Storage-80°C (lyophilized form stable for 12 months; liquid form for 6 months)
Reconstitution0.1–1.0 mg/mL in deionized water with 50% glycerol for long-term storage
TagVariable (determined during production)

Substrate Specificity

  • a-Factor Variant Processing: SPAC3H1.05 and its homologs (e.g., Afc1p, Rce1p) cleave a-factor variants with aliphatic residues (V, L, I, M) at the a1 and a2 positions, but not charged residues (D, K) .

  • Cooperation with Farnesyltransferase: Overexpression of Ram1p (farnesyltransferase β-subunit) enhances proteolysis efficiency for poorly prenylated substrates .

Genetic Interactions

  • Synthetic Lethality: SPAC3H1.05 interacts genetically with the prefoldin complex (involved in tubulin/actin folding), a conserved interaction across yeast species .

Evolutionary Insights

  • γ-Secretase Connection: Structural homology links SPAC3H1.05 to the γ-secretase subunit APH-1, suggesting an ancient evolutionary origin for intramembrane proteases .

Applications and Implications

  • Protein Maturation Studies: Used to investigate posttranslational processing of prenylated proteins in S. pombe and other eukaryotes .

  • Biotechnological Tool: Recombinant SPAC3H1.05 serves as a reagent for enzyme assays and structural studies .

  • Disease Research: Insights into CAAX protease function inform studies on cancers and progeria, where prenylation defects are implicated .

Comparative Analysis with Homologs

Protease TypeSPAC3H1.05 (Type II)Afc1p/Ste24p (Type I)
Catalytic MotifAbsent "HExxH" motif Contains "HExxH" metalloprotease motif
Substrate PreferenceBroader range of X residues Restricted to specific prenylated targets
Evolutionary OriginShares ancestry with bacterial proteasesEukaryote-specific

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery information.
Note: All protein shipments include standard blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Typically, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
SPAC3H1.05; Probable CAAX prenyl protease 1; Prenyl protein-specific endoprotease 1; PPSEP 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-474
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC3H1.05
Target Protein Sequence
MSPGLCFLKEISVIQATPKPTTRSFANCCKMGILQHLMHILDIPGFPWKIVIAGFSIGKY AWDLYLRRRQVPYLLREKPPAILAEHVDEKKYQKALSYARDKSWFSTIVSTFTLAVDLLI IKYDGLSYLWNITKFPWMDKLAASSSRFSLSTSITHSCVFMFGLTLFSRLIQIPFNLYST FVIEEKYGFNKSTLKIFVIDLLKELSLGGLLMSVVVGVFVKILTKFGDNFIMYAWGAYIV FGLILQTIAPSLIMPLFYKFTPLENGSLRTQIEELAASINFPLKKLYVIDASRRSTHSNA FFYGLPWNKGIVLFDTLVKNHTEPELIAILGHELGHWYMSHNLINTIIDYGMSLFHLFLF AAFIRNNSLYTSFNFITEKPVIVGLLLFSDALGPLSSILTFASNKVSRLCEYQADAFAKQ LGYAKDLGDGLIRIHDDNLSPLEFDSLYTSYYHSHPILVDRLNAIDYTTLKKNN
Uniprot No.

Target Background

Function
Proteolytically removes the C-terminal three residues of farnesylated proteins.
Database Links
Protein Families
Peptidase M48A family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SPAC3H1.05 and what is its function in Schizosaccharomyces pombe?

SPAC3H1.05 (also referred to as STE24 based on its S. cerevisiae ortholog) is a CAAX protease involved in the processing of prenylated proteins in the fission yeast Schizosaccharomyces pombe. This enzyme plays a critical role in post-translational modifications of proteins that contain a C-terminal CAAX motif. Functionally, it cleaves the -AAX portion of the CAAX motif after the cysteine residue has been prenylated by a farnesyltransferase or geranylgeranyltransferase, thus facilitating proper membrane localization of substrate proteins . The enzymatic action of SPAC3H1.05 is part of a sequential processing pathway that includes both prenylation and proteolytic steps, which are essential for the proper functioning of many proteins involved in signal transduction and membrane-associated processes.

How can SPAC3H1.05 gene disruption be achieved in S. pombe?

Gene disruption of SPAC3H1.05 in S. pombe can be performed using standard molecular genetics techniques adapted for fission yeast. The recommended approach involves:

  • PCR amplification of a selection marker (such as kanMX4 for G418 resistance or natMX4 for nourseothricin resistance) flanked by sequences homologous to the regions upstream and downstream of the SPAC3H1.05 open reading frame.

  • Transformation of the PCR product into S. pombe cells using the lithium acetate method.

  • Selection of transformants on appropriate antibiotic-containing media.

  • Confirmation of gene disruption by PCR, using primers that anneal outside the targeted region .

For systematic studies, researchers can use the existing deletion from the Bioneer deletion library, which contains a comprehensive collection of S. pombe deletion strains. This approach has been utilized in the construction of protease-deficient strain sets in S. pombe, where 52 different protease genes were individually disrupted .

What expression systems are suitable for recombinant production of SPAC3H1.05?

For recombinant expression of SPAC3H1.05 in S. pombe, several expression systems can be employed, each with specific advantages:

  • nmt1 Promoter System: The most widely used inducible system in S. pombe, offering tight regulation through thiamine repression. The full induction of this promoter takes 14-20 hours after thiamine removal, providing controlled expression . Three versions of this promoter with different strengths (nmt1, nmt41, nmt81) allow for tunable expression levels.

  • Faster Induction Systems: For time-sensitive experiments, alternative systems like the one designed by Watson et al. allow faster transcriptional induction in S. pombe compared to the traditional nmt1 system .

  • Constitutive Promoters: For constant expression, constitutive promoters like adh1 or ef1a-c can be used.

Expression plasmids typically incorporate S. pombe-specific features such as ars1 replication origin and appropriate selection markers (e.g., ura4+, leu1+). For purification purposes, epitope tags (His6, FLAG, or TAP) can be added to either the N- or C-terminus of SPAC3H1.05, though care must be taken to ensure that the tag does not interfere with the protease activity.

What are common challenges in purifying recombinant SPAC3H1.05?

Purification of recombinant SPAC3H1.05 from S. pombe presents several challenges that researchers should anticipate:

  • Membrane Association: As a CAAX protease, SPAC3H1.05 is membrane-associated, making solubilization a critical step. Detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin at 0.5-1% concentration are typically used for extraction from membrane fractions.

  • Proteolytic Activity: Being a protease itself, SPAC3H1.05 may undergo self-cleavage or degrade other proteins during purification. Working at lower temperatures (4°C) and including protease inhibitors that do not affect metalloproteases is recommended.

  • Protein Stability: The stability of the purified protein may be enhanced by including glycerol (10-20%) in the buffer solutions and optimizing pH and salt concentrations based on the protein's isoelectric point.

  • Yield Limitations: Expression yields may be affected by the host's endogenous proteases. Using protease-deficient strains of S. pombe, particularly those with disruptions in serine and cysteine proteases, has been shown to reduce degradation of heterologous proteins and improve yields .

A typical purification protocol would involve cell lysis by mechanical disruption, membrane fraction isolation by differential centrifugation, detergent solubilization, and purification using affinity chromatography based on the incorporated tag.

What genetic interactions of SPAC3H1.05 provide insights into its cellular functions?

Genetic interaction studies have revealed significant insights into the functional relationships of SPAC3H1.05 within the cellular network. Notably, several synthetic lethal interactions have been identified:

  • Prefoldin Complex Interaction: A particularly significant finding is the conservation of genetic interactions between SPAC3H1.05/STE24 and the prefoldin complex genes in both S. pombe and S. cerevisiae. This evolutionary conservation suggests an important functional relationship, possibly in protein quality control pathways .

  • Conserved Genetic Interaction Network: Comparative analysis between S. pombe and S. cerevisiae has identified what researchers term a "conserved yeast network" (CYN), which includes SPAC3H1.05 and its interactions. Approximately 23% of synthetic lethal or synthetic sick interactions are conserved between these two distantly related yeasts .

The table below summarizes key conserved genetic interactions identified for SPAC3H1.05:

Interacting Gene/ComplexConservation StatusInteraction TypeFunctional Implication
Prefoldin ComplexConserved in S. cerevisiaeSynthetic LethalProtein folding/quality control
Additional interactions may be present in the CYNConservedVariousShared biological processes

These genetic interactions suggest that SPAC3H1.05 functions in pathways related to protein folding and quality control, potentially affecting membrane protein processing beyond just its enzymatic role in CAAX processing.

How does SPAC3H1.05 disruption impact heterologous protein production in S. pombe?

The impact of SPAC3H1.05 disruption on heterologous protein production in S. pombe appears to be context-dependent, based on protease studies in fission yeast:

  • Potential Reduction in Proteolytic Degradation: As a member of the protease family in S. pombe, disruption of SPAC3H1.05 might reduce specific proteolytic degradation of heterologous proteins that contain CAAX motifs or related sequences. This could potentially improve yield and integrity of certain recombinant proteins.

  • System-Wide Effects: Studies on protease-deficient strains in S. pombe have shown that disruption of specific proteases can significantly reduce degradation of sensitive model proteins like human growth hormone (hGH). The most effective proteases in reducing degradation were primarily serine- and cysteine-type proteases present in the culture medium .

  • Strain Engineering Considerations: For optimal heterologous protein production, multiple protease disruptions may be necessary. The construction of protease-deficient strain sets has proven useful not only for protein production but also for functional screening and specification of proteases in S. pombe .

Researchers interested in using SPAC3H1.05-disrupted strains for recombinant protein production should evaluate whether their protein of interest contains motifs that might be recognized by this protease and conduct pilot expression studies to determine the specific impact on their system.

What methods can be used to assay the enzymatic activity of recombinant SPAC3H1.05?

Several methodological approaches can be employed to assay the enzymatic activity of recombinant SPAC3H1.05:

  • Fluorogenic Peptide Substrates: Synthetic peptides containing a CAAX motif with a fluorophore and quencher group can be used. Cleavage by SPAC3H1.05 separates the quencher from the fluorophore, resulting in increased fluorescence that can be measured in real-time.

  • Mass Spectrometry-Based Assays: This approach involves incubating the purified enzyme with a known substrate peptide and analyzing the cleavage products using liquid chromatography-mass spectrometry (LC-MS). This method provides precise information about the cleavage site and kinetics.

  • In Vivo Functional Complementation: The functionality of recombinant or mutant SPAC3H1.05 can be assessed by its ability to complement defects in SPAC3H1.05-deficient strains, particularly in the context of genetic interactions with the prefoldin complex genes.

  • Synthetic Genetic Array (SGA) Analysis: The developed S. pombe SGA (SpSGA) method can be applied to systematically identify genetic interactions of SPAC3H1.05 mutants. This approach provides insights into the functional consequences of enzymatic activity alterations in vivo .

Typical reaction conditions for enzymatic assays include:

  • Buffer: 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1 mM DTT, 1 mM ZnCl₂ (as CAAX proteases are often metalloproteases)

  • Detergent: 0.1% DDM or other non-ionic detergent to maintain enzyme solubility

  • Temperature: 30°C (standard for S. pombe proteins)

  • Controls: Heat-inactivated enzyme and reactions with protease inhibitors

How can the structure-function relationship of SPAC3H1.05 be investigated?

Investigating the structure-function relationship of SPAC3H1.05 requires a multifaceted approach:

  • Site-Directed Mutagenesis: Key residues in the catalytic site or substrate-binding regions can be mutated, and the resulting variants can be assessed for enzymatic activity using the assays described above. This approach helps identify essential residues for catalysis.

  • Domain Mapping: Truncation constructs expressing different domains of SPAC3H1.05 can be created to determine which regions are essential for activity, substrate recognition, or membrane association.

  • Structural Biology Techniques:

    • X-ray crystallography of purified SPAC3H1.05 (challenging due to membrane association)

    • Cryo-electron microscopy for structural determination

    • NMR spectroscopy for dynamics studies of specific domains

    • Homology modeling based on related CAAX proteases with known structures

  • Comparative Studies with Orthologs: Functional comparison with the S. cerevisiae ortholog (STE24) and human ortholog (ZMPSTE24) can provide insights into conserved structural features and species-specific differences.

  • Interaction Proteomics: Techniques such as BioID or proximity labeling can identify proteins that physically interact with SPAC3H1.05, potentially revealing structural regions involved in protein-protein interactions.

Such studies would be particularly valuable given the observed conservation of genetic interactions between SPAC3H1.05/STE24 and the prefoldin complex, which suggests a potentially important structural or functional relationship that remains to be fully characterized .

What is the role of SPAC3H1.05 in the context of S. pombe DNA damage and replication stress responses?

While direct evidence from the search results is limited, the role of SPAC3H1.05 in DNA damage and replication stress responses can be investigated using established S. pombe assays:

  • Synthetic Genetic Array (SpSGA) Analysis: This method has been successfully used to identify genetic interactions involving genes related to DNA replication, DNA damage response, and chromatin remodeling in S. pombe. Similar approaches could reveal if SPAC3H1.05 genetically interacts with known components of these pathways .

  • Sensitivity Assays: Testing SPAC3H1.05-disrupted strains for sensitivity to DNA-damaging agents (UV, MMS, HU, etc.) can indicate whether this protease plays a role in DNA damage repair or tolerance.

  • Recombination Assays: The mitotic recombination assays developed for S. pombe (as described in search result ) could be employed to determine if SPAC3H1.05 disruption affects homologous recombination frequencies or outcomes.

  • Replication Fork Stability: Since prenylated proteins can be involved in signaling pathways that affect replication fork stability, analyzing replication dynamics in SPAC3H1.05-disrupted strains using DNA combing or related techniques could reveal potential roles in this process.

  • Cell Cycle Analysis: Examining cell cycle progression and checkpoint activation in response to replication stress in SPAC3H1.05 mutants would provide insights into its potential role in cell cycle regulation during stress conditions.

These investigative approaches would be particularly valuable given that genetic studies in S. pombe have identified connections between diverse cellular processes, including post-translational modifications and DNA damage response pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.