Recombinant Schizosaccharomyces pombe Probable CAAX prenyl protease 2 (SPAC1687.02)

Shipped with Ice Packs
In Stock

Description

Role in Protein Prenylation

CAAX prenyl proteases cleave the "AAX" tripeptide from prenylated cysteine residues in proteins like Ras GTPases, enabling their membrane localization and signaling activity. SPAC1687.02 is a type II protease, distinct from metalloprotease-type AFC1/Ste24 enzymes. Key findings include:

  • Catalytic Mechanism: Mutational studies suggest conserved glutamate/histidine residues mediate proteolysis, though early hypotheses about cysteine dependency were later refuted .

  • Evolutionary Context: Shares homology with bacterial PrsW proteases and γ-secretase subunit APH-1, hinting at ancient roles in regulated intramembrane proteolysis .

Biological Relevance in S. pombe

  • Gene Ontology Annotations:

    • Biological Process: Protein maturation (GO:0051604) .

    • Molecular Function: CAAX prenyl protease activity (GO:0008920) .

    • Cellular Component: Endoplasmic reticulum membrane (GO:0005789) .

Research Applications

  • Enzymatic Assays: Used to study CAAX motif cleavage kinetics and substrate specificity.

  • Structural Studies: Recombinant forms enable crystallization efforts to resolve catalytic mechanisms .

  • Biotechnological Use: Optimized for high-yield expression in baculovirus systems (e.g., 50 µg/mL titers) .

Stability and Handling

  • Reconstitution: Recommended in Tris-based buffers with 50% glycerol to prevent aggregation .

  • Shelf Life: 12 months (lyophilized) or 6 months (liquid) at -80°C .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPAC1687.02; Probable CAAX prenyl protease 2; Prenyl protein-specific endoprotease 2; PPSEP 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC1687.02
Target Protein Sequence
MRVYLISFFFTAIYVVSLYTFPVARPRPSLNRNDPKVITARCISVLLASSVCCILTRLII GPSLNVFTFPTDQVLKSLLHAATIFIGPLYEVWIVDKEYRLFFIHLKDCLSNAIAWRNII IGPLSEELTFRCCIVPICEAAGWSRLKIIFVAPLLFGMAHIHHTYEFLLAYPNAYIAAAL QTVVQFSYTTVFGWYTTHLFLSTHSLFPSFLVHAFCNSMGLPTLYGKIGNRNQTRIYYTL LLLGVLIFYMTWGITDFNNHQDFEPRLVPLN
Uniprot No.

Target Background

Function
Proteolytically removes the C-terminal three residues from farnesylated proteins.
Database Links
Protein Families
Peptidase U48 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SPAC1687.02 and its function in S. pombe?

SPAC1687.02 is a probable type II CAAX prenyl protease in Schizosaccharomyces pombe that functions in the post-translational processing of prenylated proteins. As a member of the CPBP (CAAX Proteases and Bacteriocin-Processing enzymes) family, it is likely involved in proteolytic trimming of the "AAX" tripeptide from prenylated proteins containing a CAAX motif at their C-terminus . This processing step follows prenylation (typically farnesylation or geranylgeranylation) of the cysteine residue in the CAAX motif and precedes carboxyl-methylation, both of which are critical for proper membrane localization and function of the substrate proteins .

Unlike type I CAAX prenyl proteases (such as Ste24p in yeast) which contain the conserved "HExxH" motif characteristic of metalloproteases, type II proteases like SPAC1687.02 lack this motif . The catalytic mechanism of these proteases has been debated, with evidence initially suggesting they were cysteine proteases, though subsequent studies indicate they are more likely metalloproteases based on conserved glutamate and histidine residues essential for catalytic activity .

What are the key structural features of CAAX prenyl proteases?

CAAX prenyl proteases like SPAC1687.02 belong to the CPBP family and possess several key structural features that define their function:

  • Transmembrane domains: Type II CAAX proteases typically contain multiple transmembrane segments, with four predicted core transmembrane segments being common in the CPBP family .

  • Conserved sequence motifs: Despite lacking the "HExxH" motif found in type I proteases, type II CAAX proteases contain distinctive sequence motifs with conserved glutamate and histidine residues that are critical for catalysis .

  • ER membrane localization: These proteases are typically localized to the endoplasmic reticulum (ER) membrane, which is consistent with their role in processing prenylated proteins that undergo modification in the ER .

  • Substrate recognition domains: Specific regions for recognizing CAAX motifs in substrate proteins, though the exact structural details of these regions remain to be fully characterized.

These structural features allow CAAX prenyl proteases to perform their specific proteolytic function within the membrane environment where their substrate proteins reside.

How does SPAC1687.02 relate to other CAAX proteases in different species?

SPAC1687.02 belongs to the widely distributed CPBP family, which has more than 5,800 members across all domains of life . Through comparative analysis:

  • Evolutionary conservation: SPAC1687.02 shares homology with other type II CAAX proteases like Rce1p in Saccharomyces cerevisiae, which processes Ras proteins and a-factor mating pheromone .

  • Functional parallels: The proteolytic function is conserved across species, with CAAX proteases in various organisms processing prenylated proteins involved in signaling (like Ras GTPases) and cellular processes .

  • Structural similarities: Despite species differences, the core architecture of multiple transmembrane segments and key catalytic residues appears to be preserved among CPBP family members .

  • Divergent substrate specificity: Different organisms may have evolved specific substrate preferences for their CAAX proteases, reflected in subtle variations in the active site architecture.

The high conservation of CAAX proteases across different species underscores their fundamental importance in cellular function, particularly in the processing of lipid-modified signaling proteins.

What are the optimal conditions for expressing recombinant SPAC1687.02?

When expressing recombinant SPAC1687.02, researchers should consider the following optimal conditions based on the challenges of membrane protein expression:

  • Expression system selection:

    • Heterologous expression in E. coli: BL21(DE3) or C41/C43(DE3) strains specifically designed for membrane protein expression

    • Yeast expression: Pichia pastoris or S. cerevisiae for eukaryotic post-translational modifications

    • Insect cell systems (Sf9, Hi5) for higher yields of properly folded protein

  • Expression construct design:

    • Addition of fusion tags: His6, GST, or MBP tags to aid purification

    • Inclusion of TEV or PreScission protease sites for tag removal

    • Codon optimization for the chosen expression host

    • Signal sequences to direct proper membrane insertion

  • Induction parameters:

    • Lower temperatures (16-20°C) during induction to slow production and aid folding

    • Reduced inducer concentration (0.1-0.5 mM IPTG for E. coli)

    • Extended induction times (18-24 hours)

  • Membrane fraction preparation:

    • Gentle lysis methods (French press or sonication with cooling intervals)

    • Buffer composition including glycerol (10-15%) and protease inhibitors

    • Detergent screening for optimal solubilization (DDM, LMNG, or CHAPS)

For optimal activity preservation, maintaining the protein in a membrane-like environment throughout purification is critical, potentially using nanodiscs or liposomes for the final preparation.

What methods are most effective for assessing CAAX protease activity in vitro?

Several complementary approaches can be used to assess CAAX protease activity in vitro:

  • Fluorogenic peptide substrate assay:

    • Substrates: CAAX-containing peptides with fluorophore/quencher pairs

    • Detection: Increased fluorescence upon cleavage between the C and A residues

    • Quantification: Initial velocity measurements at various substrate concentrations

    • Advantage: High-throughput capability for inhibitor screening

  • HPLC-based assay:

    • Method: Separation of substrate and product peptides by reversed-phase HPLC

    • Detection: UV absorbance or fluorescence detection of cleaved products

    • Quantification: Integration of product peak areas

    • Advantage: Direct visualization of reaction products and intermediates

  • Mass spectrometry:

    • Method: MALDI-TOF or LC-MS/MS analysis of reaction products

    • Detection: Mass shifts corresponding to AAX removal

    • Advantage: Precise identification of cleavage sites and potential side reactions

  • Biochemical reconstitution:

    • System: Incorporation of purified SPAC1687.02 into proteoliposomes

    • Substrates: Full-length prenylated proteins rather than peptides

    • Detection: Western blotting with mobility shift or specific antibodies

    • Advantage: More physiologically relevant assessment of activity

A standardized assay protocol should include:

  • Buffer conditions: pH 6.5-7.5, 100-150 mM NaCl, 1-5 mM MgCl₂

  • Membrane mimetics: Detergent micelles or nanodiscs

  • Temperature: 30°C (optimal for S. pombe proteins)

  • Controls: Heat-inactivated enzyme, known inhibitors (e.g., TPCK)

How can one generate knockout or conditional mutants of SPAC1687.02 in S. pombe?

Generating knockout or conditional mutants of SPAC1687.02 in S. pombe can be approached through several strategies:

  • Complete gene deletion:

    • Homologous recombination approach using PCR-based gene targeting

    • Long homology arms (~350 bp) flanking a selectable marker like KanMX

    • Verification by PCR, sequencing, and Southern blot analysis to ensure proper integration

    • If SPAC1687.02 is essential, this approach requires using heterozygous diploid strains followed by tetrad analysis

  • Conditional expression systems:

    • Promoter replacement strategy: Replace native promoter with:

      • nmt1 promoter (three versions of different strengths, repressed by thiamine)

      • urg1 promoter (induced by uracil, rapidly responsive)

      • hsp16 promoter (heat-inducible)

    • Degron-based approaches:

      • Auxin-inducible degron (AID) system

      • Temperature-sensitive degron fusions

  • CRISPR/Cas9-based methods:

    • Design guide RNAs targeting SPAC1687.02

    • Co-transformation with repair template containing desired mutations

    • Selection and verification of edited clones

  • Point mutation introduction:

    • Site-directed mutagenesis of key catalytic residues based on conserved motifs

    • Integration at the native locus via homologous recombination

    • Particularly useful for structure-function studies of specific residues

For verification of successful modification, a comprehensive approach includes:

  • Genomic PCR with primers flanking the target region

  • Sequencing to confirm the precise genetic change

  • RT-PCR and Western blotting to verify altered expression

  • Phenotypic analysis to assess functional consequences

How does CAAX protease inhibition affect the proteome and cellular signaling pathways?

Inhibition of CAAX proteases like SPAC1687.02 has multifaceted effects on the proteome and signaling pathways:

  • Direct effects on CAAX protein processing:

    • Accumulation of prenylated but non-proteolyzed CAAX proteins

    • Altered membrane localization of key signaling proteins like Ras GTPases

    • Reduced carboxylmethylation of substrate proteins due to blocked processing

    • Changes in protein-protein interaction profiles of CAAX proteins

  • Signaling pathway disruptions:

    • Ras-mediated signaling pathways show reduced efficiency

    • MAPK cascade activation may be attenuated

    • Cell cycle regulation can be compromised due to improper localization of regulatory GTPases

    • Mating pathway signaling in yeast may be affected through altered pheromone processing

  • Proteome-wide effects:

    • Compensatory changes in expression of related proteins

    • Secondary effects on proteins that interact with mislocalized CAAX proteins

    • Potential stress responses triggered by accumulated improperly processed proteins

    • Changes in membrane composition and organization

  • Selective impacts based on substrate sensitivity:

    • Different CAAX proteins show varying dependence on proteolysis

    • Some substrates may have alternative processing mechanisms

    • Functional redundancy may exist with other proteases

A proteomics data table from studies comparing wild-type and CAAX protease-deficient cells might show:

Protein CategoryResponse to CAAX Protease InhibitionPrimary EffectSecondary Effect
Ras-related GTPasesMembrane mislocalizationReduced signaling efficiencyAltered transcriptional programs
Cell cycle regulatorsPartial mislocalizationDelayed cell cycle progressionCellular stress responses
Mating factorsProcessing defectsReduced mating efficiencyAltered gene expression
Stress response proteinsUpregulationCompensatory mechanismProtection against proteotoxicity
Membrane organization proteinsAltered distributionChanged membrane propertiesModified protein trafficking

What is the substrate specificity of SPAC1687.02 compared to other CAAX proteases?

SPAC1687.02 likely exhibits distinct substrate specificity patterns compared to other CAAX proteases, influenced by several factors:

  • CAAX motif recognition determinants:

    • The "X" residue in the CAAX motif significantly influences specificity

    • The nature of the "AA" aliphatic residues affects recognition efficiency

    • Upstream sequences adjacent to the CAAX motif contribute to recognition context

  • Comparative specificity profile:

    • S. pombe CAAX proteases may preferentially process certain subsets of prenylated proteins

    • The YPT/rab proteins with XCC or CXC motifs represent potential differential substrates

    • Cross-species comparisons reveal evolutionary specialization of CAAX proteases

  • Structural basis for specificity:

    • Variations in the binding pocket architecture determine substrate preferences

    • Conserved catalytic residues position substrates for efficient proteolysis

    • Surface charge distribution and hydrophobicity patterns influence substrate docking

  • Experimental evidence for specificity:

    • Proteolysis-resistant CAAX sequences (e.g., CASQ) can be used to probe specificity boundaries

    • Substrate competition assays reveal preferential processing hierarchies

    • Mutagenesis studies identify critical residues for substrate discrimination

A specificity comparison table might look like:

Substrate FeatureSPAC1687.02 PreferenceComparison to S. cerevisiae Rce1pFunctional Implication
"X" residueMethionine, SerineBroader specificity includes LeucineSelective processing of specific signaling proteins
"AA" compositionPreference for bulky hydrophobicsSimilar preference but less stringentDifferential processing rates for substrate subsets
Secondary modificationsAccommodates palmitoylated substratesSimilar capabilityCoordination with other post-translational modifications
Structural contextRequires minimal unfolded C-terminusProcesses more structurally hindered substratesImpact on processing kinetics in native environment
Processing rateSlower but more selectiveFaster but less discriminatingBalance between efficiency and specificity

How do post-translational modifications affect SPAC1687.02 function and regulation?

SPAC1687.02, like other membrane-bound proteases, is likely subject to various post-translational modifications that regulate its activity, localization, and stability:

  • Phosphorylation:

    • Potential sites: Serine/threonine residues in cytoplasmic loops

    • Regulating kinases: May include stress-responsive and cell cycle kinases

    • Functional impact: Activity modulation, protein-protein interactions, subcellular targeting

    • Temporal regulation: Potentially cell cycle-dependent or stress-responsive

  • Ubiquitination:

    • Targets: Lysine residues in cytoplasmic domains

    • Functional consequences: Degradation targeting, trafficking regulation

    • Regulatory dynamics: May respond to ER stress or unfolded protein response

    • E3 ligases involved: Likely include ER-associated degradation machinery components

  • Proteolytic processing:

    • Potential for auto-processing or cleavage by other proteases

    • Activation mechanisms: Removal of inhibitory propeptides

    • Regulation: Controlled proteolysis in response to cellular stimuli

  • Membrane environment interactions:

    • Lipid raft association as a regulatory mechanism

    • Cholesterol-dependent activity modulation

    • Lateral segregation affecting substrate accessibility

  • Protein-protein interactions:

    • Binding partners that modulate activity or substrate access

    • Complex formation with other CAAX processing enzymes

    • Scaffold proteins that coordinate sequential processing events

A regulatory model might include:

Modification TypeResidues AffectedCellular ConditionEffect on SPAC1687.02
PhosphorylationS245, T267, S312Nutrient stressIncreased catalytic activity
PhosphorylationS182Cell cycle (G2/M)Altered substrate specificity
UbiquitinationK134, K296ER stressProteasomal degradation targeting
PalmitoylationC122Membrane reorganizationEnhanced membrane microdomain association
Proteolytic cleavageAfter R27Protein maturationRemoval of inhibitory N-terminal segment

What are common challenges in purifying active SPAC1687.02 and how can they be overcome?

Purifying active membrane proteases like SPAC1687.02 presents several challenges that require specific strategies:

  • Low expression yields:

    • Challenge: Membrane protein overexpression often leads to toxicity and aggregation

    • Solutions:

      • Use specialized expression strains (C41/C43 for E. coli, protease-deficient strains for yeast)

      • Lower induction temperatures (16-20°C)

      • Codon optimization and removal of rare codons

      • Consider cell-free expression systems with supplied lipids or detergents

  • Protein aggregation:

    • Challenge: Hydrophobic transmembrane domains promote aggregation during extraction

    • Solutions:

      • Screening multiple detergents (DDM, LMNG, GDN, CHAPS)

      • Addition of stabilizing lipids (cholesterol, specific phospholipids)

      • Inclusion of glycerol (10-20%) in all buffers

      • Use of amphipols or nanodiscs for final preparation

  • Loss of activity during purification:

    • Challenge: Removal from native membrane environment often compromises function

    • Solutions:

      • Develop activity assays for each purification step to track activity

      • Reconstitution into proteoliposomes with defined lipid composition

      • Minimize exposure to harsh conditions (extreme pH, high salt)

      • Include substrate analogs or inhibitors during purification as stabilizers

  • Heterogeneity in purified preparations:

    • Challenge: Multiple conformational states or degradation products

    • Solutions:

      • Size exclusion chromatography to separate aggregates and oligomeric states

      • Affinity tags at both N- and C-termini to ensure full-length protein

      • Mass spectrometry quality control of final preparations

      • Use of nanobodies or conformation-specific antibodies for purification

A systematic purification optimization approach might include:

Purification StepCritical ParametersQuality ControlTroubleshooting
Membrane preparationGentle cell disruption, buffer pH 7.2-7.5Microscopy for membrane integrityAdjust lysozyme concentration, sonication cycles
Detergent extractionDetergent:protein ratio, time, temperatureProtein yield, removal of aggregatesScreen detergent panel, adjust extraction time
Affinity chromatographyFlow rate, binding buffer compositionSDS-PAGE, Western blotIncrease imidazole in wash, reduce flow rate
Size exclusionSample concentration, buffer compositionPeak symmetry, activity assayPre-filter sample, optimize detergent concentration
ReconstitutionLipid:protein ratio, detergent removal methodLiposome size, protein orientationAdjust lipid composition, dialysis conditions

How can researchers distinguish between the effects of SPAC1687.02 inhibition and other CAAX-processing enzymes?

Distinguishing the specific effects of SPAC1687.02 inhibition from other CAAX-processing enzymes requires targeted approaches:

  • Genetic approaches for specificity:

    • Proteolysis-resistant CAAX sequence modification: Using a CASQ sequence instead of CAAX can specifically prevent proteolysis while allowing prenylation

    • Gene replacement strategies: Swap wild-type SPAC1687.02 with catalytically inactive mutants while maintaining other processing enzymes

    • Conditional expression systems: Rapidly inducible or repressible SPAC1687.02 expression to observe acute effects

  • Biochemical discrimination techniques:

    • Sequential enzyme assays: Isolate individual steps in the CAAX processing pathway

    • Specific substrate design: Create substrates that are exclusively processed by SPAC1687.02

    • Selective inhibitors: Develop compounds with specificity for SPAC1687.02 over other proteases

  • Molecular readouts for differentiation:

    • Mass spectrometry analysis: Identify specific proteolytic signatures characteristic of SPAC1687.02

    • Subcellular localization patterns: Map distinctive mislocalization patterns for SPAC1687.02 substrates

    • Protein-protein interaction alterations: Determine interaction changes specific to SPAC1687.02 inhibition

  • Comparative phenotypic analysis:

    • Cross-species complementation: Test if other CAAX proteases can rescue SPAC1687.02 deficiency

    • Substrate rescue experiments: Express substrates with modifications that bypass the need for SPAC1687.02

    • Epistasis analysis: Determine genetic interactions specific to SPAC1687.02 pathway

A decision matrix for distinguishing enzyme effects might include:

ObservationLikely Due to SPAC1687.02 InhibitionLikely Due to Other CAAX Processing EnzymesConfirmatory Experiment
Accumulation of farnesylated, non-proteolyzed proteinsYesNoMass spectrometry of C-terminal peptides
Altered ER membrane morphologyPossiblyPossiblyElectron microscopy with SPAC1687.02-specific mutants
Mislocalization of Ras-related proteinsYesYes, if farnesyltransferase inhibitedCASQ mutant expression
Growth defects in specific conditionsYes, if condition-specificYes, if general prenylation defectConditional complementation assay
Altered mating efficiencyYes, if pheromone processing affectedYes, if general membrane organization disruptedPheromone bypass experiments

What are the best approaches for studying SPAC1687.02 protein-protein interactions?

Studying protein-protein interactions of membrane-integrated proteases like SPAC1687.02 requires specialized approaches:

  • Membrane-compatible affinity purification methods:

    • Tandem Affinity Purification (TAP): Modified for membrane proteins with detergent-resistant tags

    • BioID or TurboID proximity labeling: Fusion of biotin ligase to SPAC1687.02 to label proximal proteins

    • APEX2 proximity labeling: Electron microscopy-compatible labeling of interaction neighborhood

    • Split-ubiquitin yeast two-hybrid: Specifically designed for membrane protein interactions

  • Real-time interaction monitoring in intact cells:

    • Förster Resonance Energy Transfer (FRET): Between SPAC1687.02 and potential partners

    • Bimolecular Fluorescence Complementation (BiFC): Visual confirmation of interactions in native context

    • Fluorescence Correlation Spectroscopy (FCS): For dynamic interaction kinetics in membranes

    • Fluorescence Recovery After Photobleaching (FRAP): To assess complex formation through diffusion changes

  • Crosslinking-based approaches:

    • Photo-amino acid incorporation: Site-specific crosslinking at defined positions

    • Chemical crosslinking mass spectrometry (XL-MS): Map interaction interfaces

    • DSSO or other MS-cleavable crosslinkers: For improved identification of crosslinked peptides

    • In vivo crosslinking followed by immunoprecipitation: Capture transient interactions

  • Computational prediction and validation:

    • Molecular docking simulations: Predict structural complementarity

    • Evolutionary coupling analysis: Identify co-evolving residues as potential interaction sites

    • Network analysis of genetic interactions: Infer functional relationships

    • Structural modeling of transmembrane domain interactions

A systematic approach to interaction mapping might include:

MethodAdvantagesLimitationsBest Applications
TAP-MS with digitonin extractionPreserves native complexesMay miss transient interactionsCore complex components identification
BioID proximity labelingCaptures weak/transient interactionsNon-specific labeling of proximal non-interactorsMapping interaction neighborhood in native context
Site-specific photocrosslinkingPrecise interaction site mappingRequires amino acid replacementDetailed structural analysis of specific interfaces
Split-ubiquitin yeast two-hybridSpecific for membrane proteinsFalse positives/negativesInitial screening of potential interactors
FRET microscopyReal-time interaction dynamicsRequires fluorescent protein fusionsSpatial and temporal regulation of interactions

What emerging technologies could advance our understanding of CAAX proteases?

Several cutting-edge technologies show promise for deepening our understanding of CAAX proteases like SPAC1687.02:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy: Near-atomic resolution structures of membrane-embedded CAAX proteases

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping conformational dynamics and substrate interactions

    • Microcrystal electron diffraction (MicroED): Structure determination from nano-sized crystals

    • AlphaFold2 and other AI structure prediction: Generating structural models and identifying critical domains

  • Single-molecule techniques:

    • Single-molecule FRET: Monitoring conformational changes during catalysis

    • Optical tweezers combined with fluorescence: Force-dependent enzymatic activity measurement

    • Nanopore recording: Electrical detection of single proteolysis events

    • Single-particle tracking: Membrane diffusion and organization in living cells

  • Advanced genetic and genomic approaches:

    • CRISPR base editors: Precise single nucleotide modifications without double-strand breaks

    • Prime editing: Complex genomic edits with minimal off-target effects

    • Saturation mutagenesis with deep sequencing: Comprehensive structure-function relationships

    • Synthetic genetic arrays: Systematic mapping of genetic interactions

  • Chemical biology innovations:

    • Activity-based protein profiling (ABPP): Selective labeling of active CAAX proteases

    • Click chemistry substrates: Bioorthogonal monitoring of proteolysis in vivo

    • Photocaged substrates: Spatiotemporal control of substrate availability

    • Proximity-induced drug targeting: Selective inhibition in specific cellular compartments

Implementation timeline and impact assessment:

TechnologyImplementation TimelineTechnical ChallengesPotential Impact
Cryo-EM structures1-3 yearsSample preparation, conformational heterogeneityRational drug design, mechanism elucidation
Prime editing of S. pombe1-2 yearsDelivery methods, editing efficiencyPrecise structure-function studies
Single-molecule FRET2-4 yearsLabeling strategies, signal-to-noiseReal-time catalytic mechanism insights
ABPP probes1-2 yearsSelectivity, membrane permeabilityIn vivo activity profiling
AI-based structure predictionImmediateValidation, membrane protein accuracyHypothesis generation, interaction modeling

How might understanding SPAC1687.02 contribute to broader knowledge of membrane protein evolution?

SPAC1687.02 research offers several avenues for advancing our understanding of membrane protein evolution:

  • Evolutionary trajectories of membrane proteases:

    • SPAC1687.02 belongs to the CPBP family with over 5,800 members across all domains of life

    • Comparative genomics can reveal how these proteases diversified from common ancestors

    • Identification of conserved motifs versus variable regions illuminates functional constraints

    • Reconstruction of the evolutionary history of type II CAAX proteases provides insights into eukaryotic cell compartmentalization

  • Co-evolution with substrate proteins:

    • CAAX proteases and their substrates (like Ras family proteins) show coordinated evolutionary patterns

    • Analysis of SPAC1687.02 orthologs and their substrates across species reveals co-evolutionary signatures

    • Changes in substrate recognition specificity track with evolutionary innovations in signaling pathways

    • Expansion or contraction of CAAX protease families correlates with organism complexity

  • Adaptation to different membrane environments:

    • Membrane composition varies across species and organelles

    • CAAX proteases show adaptations to specific lipid environments

    • Analysis of transmembrane domains reveals selection patterns related to membrane thickness and fluidity

    • Localization mechanisms evolved alongside compartmentalization of eukaryotic cells

  • Structural innovation and conservation:

    • Core catalytic elements show high conservation despite sequence divergence

    • Peripheral domains exhibit greater variability, suggesting functional specialization

    • Emergence of regulatory domains tracks with increasing cellular complexity

    • Ancient conserved elements reveal fundamental aspects of membrane protein structure

A conceptual framework for evolutionary analysis:

Evolutionary AspectObservation in SPAC1687.02Broader ImplicationResearch Approach
Sequence conservation patternsHighly conserved transmembrane core, variable loopsFunctional constraints in membrane proteinsComparative sequence analysis across kingdoms
Phylogenetic distributionPresent in all eukaryotes, related to bacterial proteasesAncient origin of CAAX processingPhylogenetic tree construction with bacterial homologs
Structural innovationSpecialized substrate binding regionsAdaptation to specific signaling proteinsStructure prediction and conservation mapping
Catalytic mechanismConserved catalytic residues despite sequence divergenceConvergent evolution of proteolytic mechanismsAncestral sequence reconstruction
Regulatory adaptationSpecies-specific regulatory domainsIncreasing complexity of regulationDomain architecture analysis across species

What are potential therapeutic applications targeting CAAX proteases in human disease models?

While focusing on the S. pombe SPAC1687.02, research in this area has significant translational potential for human CAAX proteases and related diseases:

  • Cancer therapy applications:

    • Rationale: Human CAAX proteases process oncogenic Ras proteins, which are mutated in ~30% of all cancers

    • Approach: Develop selective inhibitors of human CAAX proteases based on structural insights

    • Advantage over farnesyltransferase inhibitors: More selective targeting of specific Ras processing steps

    • Combined therapy: Synergistic effects with other Ras pathway inhibitors

    • Biomarker development: Identify patient populations most likely to respond to CAAX protease inhibition

  • Neurodegenerative disease relevance:

    • Connection: SPAC1687.02 shares evolutionary links with APH-1, a component of γ-secretase

    • Implication: Better understanding of transmembrane protease mechanisms relevant to Alzheimer's disease

    • Approach: Comparative studies between CAAX proteases and γ-secretase components

    • Potential application: Novel mechanistic insights into amyloid processing

  • Infectious disease applications:

    • Target: Pathogen-specific CAAX proteases essential for virulence

    • Model: Use S. pombe system to test inhibitor specificity and effects

    • Advantage: Evolutionary distance allows for selective targeting of pathogen enzymes

    • Applications: Antifungal, antiparasitic, or antibacterial therapeutics

  • Progeria and premature aging disorders:

    • Relevance: Defects in lamin A processing by CAAX proteases contribute to Hutchinson-Gilford Progeria Syndrome

    • Approach: Using yeast models to understand processing mechanisms

    • Therapeutic strategy: Correcting abnormal farnesylation or proteolysis

    • Screening platform: S. pombe as a simplified system for drug discovery

Translational research roadmap:

Disease TargetResearch ApproachTimelineKey ChallengesPotential Impact
Ras-driven cancersStructure-based inhibitor design3-5 yearsSelectivity, membrane permeabilityNew class of targeted cancer therapeutics
Alzheimer's diseaseComparative mechanism studies2-4 yearsComplex multi-subunit targetsNovel approaches to modulate γ-secretase
Fungal infectionsSpecies-selective inhibitor screening2-3 yearsDelivery to infection siteAlternatives to current antifungals
Progeria syndromeCorrective processing approaches3-6 yearsTissue-specific deliveryFirst treatments for accelerated aging

What bioinformatic approaches are most useful for analyzing CAAX protease sequences?

Comprehensive bioinformatic analysis of CAAX proteases like SPAC1687.02 requires integrated approaches:

  • Sequence-based analyses:

    • Profile Hidden Markov Models (HMMs): Detect distant homologs across diverse species

    • Position-Specific Scoring Matrices (PSSMs): Identify conserved motifs characteristic of CAAX proteases

    • Multiple sequence alignment (MSA) with membrane-protein specific algorithms: Accurately align transmembrane regions

    • Conservation analysis: Identify functionally critical residues with programs like ConSurf or Rate4Site

  • Structural bioinformatics:

    • Transmembrane topology prediction: TMHMM, TOPCONS, or MEMSAT for membrane spanning segments

    • Homology modeling: Using solved structures of related proteases as templates

    • Molecular dynamics simulations: Analyze protein behavior in membrane environments

    • Protein-protein docking: Predict interactions with substrate proteins

  • Evolutionary analyses:

    • Phylogenetic tree construction: Maximum likelihood or Bayesian approaches for evolutionary relationships

    • Coevolution analysis: Identify coordinated evolution between residues using methods like EVcouplings

    • Ancestral sequence reconstruction: Infer properties of ancestral CAAX proteases

    • Selection pressure analysis: Identify sites under positive or negative selection

  • Functional prediction:

    • Catalytic site prediction: Identify potential active site residues

    • Substrate specificity prediction: Machine learning approaches to predict CAAX motif preferences

    • Protein-protein interaction networks: Contextual analysis of CAAX proteases in cellular pathways

    • Gene neighborhood analysis: Identify functionally related genes in prokaryotic homologs

A systematic bioinformatic workflow might include:

Analysis StepTools and ResourcesExpected OutcomesInterpretation Guidelines
Homology detectionHHpred, HMMer, PSI-BLASTComprehensive family membershipE-value thresholds, coverage assessment
Motif identificationMEME, GLAM2, PROSITEConserved sequence patternsCorrelation with structural features
Transmembrane predictionTMHMM, TOPCONS, MEMSATMembrane topology modelConsensus from multiple predictors
Evolutionary analysisIQ-TREE, MrBayes, PAMLPhylogenetic relationships, selection patternsModel testing, statistical support
Structure predictionAlphaFold2, I-TASSER, SWISS-MODEL3D structural modelsQuality assessment with QMEAN, MolProbity
Function predictionInterProScan, Pfam, SUPERFAMILYDomain architecture, functional classificationIntegration of multiple annotations

How should researchers interpret contradictory results in CAAX protease studies?

Contradictory results are common in challenging research areas like CAAX proteases, requiring systematic approaches to resolution:

  • Methodological differences assessment:

    • Experimental system variations: Different expression systems, purification methods, or assay conditions

    • Substrate differences: Synthetic peptides versus full-length proteins, different CAAX sequences

    • Detection method sensitivity: Direct versus indirect activity measurements

    • Technical artifacts: Detergent effects, buffer composition, protein stability considerations

  • Biological context considerations:

    • Species-specific variations: Different organisms may have evolved unique regulatory mechanisms

    • Cellular environment: Membrane composition, pH, redox state differences

    • Protein interaction networks: Presence or absence of accessory factors

    • Post-translational modifications: Different modification states affecting activity or localization

  • Analytical framework for resolution:

    • Replication with standardized protocols: Perform side-by-side comparisons under identical conditions

    • Orthogonal approaches: Validate findings using multiple independent methodologies

    • Dose-response relationships: Evaluate concentration-dependent effects that may explain threshold differences

    • Temporal dynamics: Consider time-dependent changes that could reconcile apparently contradictory snapshots

  • Integrative analysis strategies:

    • Meta-analysis of published data: Systematic review with weighted evidence assessment

    • Bayesian inference: Update confidence based on cumulative evidence

    • Mathematical modeling: Develop predictive models that accommodate seemingly contradictory observations

    • Collaborative validation: Multi-laboratory testing of controversial findings

A decision matrix for resolving contradictions:

Contradiction TypeExample in CAAX Protease FieldInvestigation ApproachResolution Strategy
Catalytic mechanismMetalloprotease vs. cysteine protease Site-directed mutagenesis, inhibitor profilingConsidering indirect effects of mutations
Substrate specificityDifferent reported preferences for CAAX X residueSystematic substrate profiling, kinetic analysisDefining context-dependent specificity rules
Cellular functionDifferent phenotypes in knockout studiesConditional alleles, acute inhibitionIdentifying compensatory mechanisms
Structural featuresConflicting topology modelsCysteine accessibility, epitope mappingIntegrating multiple structural constraints
Regulatory mechanismsContradictory regulation reportsCell-type specific analysis, controlled conditionsMapping context-dependent regulatory networks

What quantitative approaches best characterize CAAX protease kinetics and substrate specificity?

Rigorous quantitative analysis of CAAX protease activity requires specialized approaches for membrane enzymes:

  • Steady-state kinetic analysis:

    • Michaelis-Menten parameter determination: Km, kcat, kcat/Km for various substrates

    • Competitive substrate analysis: Determine relative preferences through competition experiments

    • Inhibition kinetics: Ki values and inhibition mechanisms (competitive, non-competitive, uncompetitive)

    • Effects of membrane environment: Detergent, lipid composition, and phase effects on kinetic parameters

  • Pre-steady-state kinetics:

    • Stopped-flow fluorescence: Monitor rapid conformational changes

    • Quenched-flow analysis: Capture short-lived intermediates

    • Single-turnover kinetics: Isolate individual steps in the catalytic cycle

    • Burst phase analysis: Identify rate-limiting steps

  • Substrate specificity profiling:

    • Peptide library screening: Systematically vary CAAX motif residues

    • Positional scanning libraries: Determine contribution of each position to specificity

    • Quantitative structure-activity relationships (QSAR): Correlate substrate properties with activity

    • Proteome-wide identification of natural substrates: MS-based approaches

  • Mathematical modeling approaches:

    • Integrated rate equations for membrane-bound enzymes

    • Stochastic simulations of enzyme behavior in restricted membrane environments

    • Global fitting of complex kinetic schemes

    • Population distribution modeling for heterogeneous enzyme preparations

A comprehensive kinetic analysis framework:

ParameterMeasurement ApproachTechnical ConsiderationsBiological Interpretation
KmSubstrate titration with detergent-solubilized enzymeSubstrate solubility, detergent interferenceAffinity for substrate in membrane context
kcatInitial velocity at saturating substrateEnsuring linear conditions, accurate enzyme quantificationMaximal processing capacity per enzyme molecule
Substrate specificity constant (kcat/Km)Comparison across substrate variantsConsistent assay conditions, statistical validationRelative efficiency for different substrates
Inhibition constants (Ki)Inhibitor titration at multiple substrate concentrationsInhibitor solubility, binding kineticsMechanism of inhibition, structure-activity relationships
Activation energy (Ea)Temperature dependence of reaction ratesProtein stability at different temperaturesEnergy barriers in catalytic mechanism

Systematic analysis of specificity determinants might generate data like:

CAAX Motif VariantRelative Activity (%)Binding Affinity (Km, μM)Catalytic Efficiency (kcat/Km, M⁻¹s⁻¹)Major Product
CVIM (Ras)1005.23.8 × 10⁴Fully processed C-terminus
CVIL856.82.5 × 10⁴Fully processed C-terminus
CVIQ4215.30.8 × 10⁴Partially processed intermediate
CASQ<5>50<0.1 × 10⁴Unprocessed substrate
CVIA787.12.2 × 10⁴Fully processed C-terminus
CAIM3618.20.6 × 10⁴Mixed products

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.