Recombinant Schizosaccharomyces pombe Probable cytochrome b5 2 (SPCC16A11.10c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
oca8; SPCC16A11.10c; Probable cytochrome b5 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
oca8
Target Protein Sequence
MAEKTITVEEVLKHNTRDDLYIVVKDKVYDISKFLDAHPGGEEVLVDLAGRDASGPFEDV GHSEDAQELLEKFYIGNLLRTEDGPQLPTTGAAAGGSGYDSSQPVKPAMWLFVLVMVVAY FAFRKYVLK
Uniprot No.

Target Background

Function

Membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.

Database Links
Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side. Mitochondrion.

Q&A

How is cytochrome b5 2 regulated in S. pombe and what cellular compartments does it localize to?

The SPCC16A11.10c gene exhibits regulation patterns associated with iron availability, showing a fold change of 2.2-2.5 in relevant studies . Like other cytochrome b5 proteins, it is likely regulated through both transcriptional mechanisms and post-translational modifications.

Regarding localization, cytochrome b5 proteins typically anchor to cellular membranes via a single transmembrane domain near the C-terminus. The S. pombe cytochrome b5 2 is predicted to localize primarily to the endoplasmic reticulum (ER) membrane, with its N-terminal heme-binding domain facing the cytosol . Some studies in other organisms have shown that cytochrome b5 can also localize to the outer mitochondrial membrane. Microscopy techniques such as immunofluorescence with tagged versions of the protein would be required to confirm its precise subcellular distribution in S. pombe .

What are the optimal conditions for expressing and purifying recombinant S. pombe cytochrome b5 2?

For successful expression and purification of recombinant S. pombe cytochrome b5 2:

  • Expression system selection: E. coli BL21(DE3) is commonly used for cytochrome b5 expression, though specialized strains that co-express heme biosynthesis genes may improve heme incorporation.

  • Expression conditions:

    • Induce at OD600 of 0.6-0.8 with 0.5-1.0 mM IPTG

    • Addition of δ-aminolevulinic acid (0.5 mM) to culture medium enhances heme incorporation

    • Lower post-induction temperature (16-20°C) often improves protein folding

    • Extended expression time (12-16 hours) maximizes yield

  • Purification protocol:

    • Lysis in Tris-based buffer (50 mM Tris-HCl, pH 8.0, 300 mM NaCl)

    • Initial purification via IMAC (if His-tagged) or ion exchange chromatography

    • Secondary purification via size exclusion chromatography

    • Final storage in Tris-based buffer with 50% glycerol at -20°C

  • Quality control:

    • Verify heme incorporation via UV-visible spectroscopy (characteristic peaks at 557, 527, and 425 nm when reduced)

    • Assess purity via SDS-PAGE

    • Confirm functionality through electron transfer assays

Avoid repeated freeze-thaw cycles of the purified protein as this may compromise stability. For extended storage, maintain at -80°C; for working solutions, store aliquots at 4°C for up to one week .

What methodologies are most effective for studying cytochrome b5 2 interactions with cytochrome P450 enzymes?

Multiple complementary approaches provide the most comprehensive understanding of cytochrome b5-P450 interactions:

  • Solution NMR spectroscopy: This technique has proven highly effective for identifying specific residues involved in protein-protein interactions. Chemical shift perturbation experiments can map the binding interface between cytochrome b5 and various P450 enzymes. Studies have revealed that P450 enzymes bind to either cytochrome b5 α4-5 regions or both α4-5 and α2-3 regions, depending on the specific P450 enzyme .

  • Site-directed mutagenesis: Systematic mutation of key residues (particularly in the α2-3 and α4-5 regions) followed by functional assays helps determine which amino acids are essential for interaction. This approach has demonstrated that different cytochrome b5 surfaces are responsible for binding different P450 enzymes .

  • Co-immunoprecipitation: This technique confirms physical interactions between cytochrome b5 and P450 enzymes in cellular contexts.

  • Functional enzyme assays: Measuring P450 activity in the presence of wild-type versus mutated forms of cytochrome b5 at varying ratios. The standard P450:CPR:cytochrome b5 ratio of 1:2:2 is often used, though optimization for specific combinations may be necessary .

  • Electron transfer kinetics: Stopped-flow spectroscopy can measure the rate of electron transfer from cytochrome b5 to P450 enzymes.

When designing experiments, consider that cytochrome b5 can have stimulatory, inhibitory, or no effect on P450 activity, depending on the specific P450 enzyme and substrate being tested .

How can genetic manipulation of the SPCC16A11.10c gene be used to study its function in S. pombe?

Systematic genetic manipulation approaches for studying SPCC16A11.10c function include:

  • Gene deletion (knockout) strategy:

    • Generate deletion cassettes using PCR-based methods with selection markers (e.g., kanMX6)

    • Transform S. pombe using standard lithium acetate method

    • Confirm gene deletion via PCR verification using primers that anneal to regions flanking the targeted locus

    • Phenotypic analysis should focus on growth under various conditions, including oxidative stress, altered lipid composition, and cell cycle progression

  • Conditional expression systems:

    • For essential functions, employ the nmt1 promoter system with thiamine-controlled expression

    • Create expression constructs with varying promoter strengths (nmt1, nmt41, nmt81)

    • Integrate at the leu1 locus for stable expression

  • Protein tagging strategies:

    • C-terminal tagging is preferable to avoid disrupting the N-terminal heme-binding domain

    • GFP tagging for localization studies

    • TAP or FLAG tagging for protein complex purification

    • Consider the impact of tags on membrane insertion properties

  • CRISPR-Cas9 applications:

    • For precise nucleotide substitutions to study specific protein domains

    • Target conserved heme-binding motifs to assess their importance

    • Engineer specific mutations analogous to those characterized in other organisms

  • Synthetic genetic array analysis:

    • Cross SPCC16A11.10c mutants with the S. pombe deletion library

    • Identify genetic interactions through growth phenotype analysis

    • Focus particularly on interactions with genes involved in lipid metabolism, electron transport, and cellular redox homeostasis

These approaches have revealed that while some cytochrome b5-related genes may not be essential under standard laboratory conditions, they often play crucial roles under specific stress conditions or in particular metabolic contexts.

What insights can transcriptomic and proteomic analyses provide about the role of cytochrome b5 2 in S. pombe cellular metabolism?

Integrative -omics approaches can reveal the functional context of cytochrome b5 2 in S. pombe:

Transcriptomic analysis approaches:

  • RNA-Seq comparing wild-type and cytochrome b5 2 deletion strains under various conditions

  • Time-course experiments during cell cycle progression or stress response

  • RNA-Seq coupled with TF ChIP-seq to identify transcription factors regulating cytochrome b5 2

Proteomic analysis approaches:

  • Immunoprecipitation-mass spectrometry to identify protein interaction partners

  • Quantitative proteomics to assess protein abundance changes in response to cytochrome b5 2 deletion

  • Post-translational modification mapping to identify regulatory mechanisms

Key data integration strategies:

  • Correlation of transcriptomic and proteomic changes to identify primary vs. secondary effects

  • Network analysis to place cytochrome b5 2 in functional pathways

  • Comparative analysis with homologous proteins in other organisms

Research findings indicate cytochrome b5 is intimately connected to:

  • Lipid metabolism pathways, particularly fatty acid elongation and desaturation

  • Ergosterol biosynthesis, as suggested by co-regulation with erg5+ (C-22 sterol desaturase)

  • Iron homeostasis networks, showing 2.2-2.5 fold changes in response to iron availability

  • Electron transport chains, potentially interacting with cytochrome c oxidase subunits and ubiquinol-cytochrome c reductase complex components

This multi-level analysis approach has revealed that cytochrome b5 proteins function within complex metabolic networks, with effects extending beyond their immediate electron transfer roles.

How does S. pombe cytochrome b5 2 compare structurally and functionally to homologs in other organisms?

Comparative analysis reveals both conservation and divergence in cytochrome b5 proteins across different organisms:

OrganismSequence Identity to S. pombe cytb5 2Membrane AssociationKey Structural DifferencesFunctional Specialization
Human (microsomal)~25%C-terminal anchorExtended C-terminusP450 interaction, lipid metabolism
Acanthamoeba castellanii~25%C-terminal anchorVariable loop regionsUnknown
Viral cytochrome b5≤25%N-terminal anchor or solubleUnique N-terminal regionPossibly lipid metabolism during host infection
S. cerevisiae~30-35%C-terminal anchorMinor differences in heme pocketFatty acid desaturation
Plants~20-25%Both forms presentVariable N-terminal extensionsDiverse roles in lipid biosynthesis

Despite this divergence, the core heme-binding domain structure remains remarkably conserved, with preserved secondary structure elements in the order β1-α1-β4-β3-α2-α3-β5-α4-α5-β2-α6 across all kingdoms of life . The two histidine residues that coordinate the heme group are invariant, residing in the loops between helices α2-α3 and α4-α5.

Functionally, cytochrome b5 proteins all serve as electron carriers, but their precise roles have diversified through evolution. While human cytochrome b5 has been extensively characterized for its role in P450-mediated drug metabolism , viral cytochrome b5 proteins may be involved in lipid metabolism during host infection . The S. pombe cytochrome b5 2 likely functions similarly to other fungal homologs in supporting lipid biosynthesis and possibly stress responses.

What evidence exists for the evolutionary origin of cytochrome b5 genes in eukaryotes and what does this suggest about their conserved functions?

The evolutionary history of cytochrome b5 offers insights into its fundamental biological importance:

  • Phylogenetic distribution: Cytochrome b5 is found across all domains of life, suggesting an ancient origin predating the divergence of major lineages. Recent discoveries of cytochrome b5 genes in giant viruses complicate this picture, raising questions about potential horizontal gene transfer events .

  • Domain architecture evolution: The core heme-binding domain shows remarkable conservation, while membrane-anchoring domains have diverged significantly. Some organisms possess both membrane-bound and soluble forms, suggesting functional specialization following gene duplication events .

  • Genomic context analysis: In S. pombe, cytochrome b5 2 (SPCC16A11.10c) is located on chromosome 3, and its genomic neighborhood contains genes involved in diverse cellular processes, which may reflect its integration into multiple metabolic pathways throughout evolution.

  • Sequence conservation patterns:

    • The heme-binding motif (-HPGG-) is invariant across species

    • Membrane anchors show higher sequence divergence

    • Residues at the protein-protein interaction interface show lineage-specific conservation patterns

  • Virus-host relationships: Viral cytochrome b5 genes share only 25% sequence identity with those in potential host organisms like Acanthamoeba castellanii, suggesting either ancient acquisition or convergent evolution. Viral cytochrome b5 proteins uniquely feature N-terminal transmembrane anchors rather than the C-terminal anchors typical in eukaryotes .

This evolutionary history suggests that while electron transfer is the conserved ancestral function of cytochrome b5, its integration into specific metabolic pathways (lipid biosynthesis, P450 systems, etc.) represents more recent evolutionary adaptations in different lineages. The presence of these genes across such diverse organisms underscores their fundamental importance in cellular metabolism.

What is the role of cytochrome b5 2 in S. pombe lipid metabolism and membrane organization?

While direct experimental evidence specific to S. pombe cytochrome b5 2 is limited, comparative analysis with homologs suggests significant roles in lipid metabolism:

  • Fatty acid desaturation: Cytochrome b5 serves as an electron donor to fatty acid desaturases, enzymes that introduce double bonds into fatty acid chains. In S. pombe, this likely affects membrane fluidity and responses to temperature changes. The protein's predicted interaction with erg5+ (C-22 sterol desaturase) suggests involvement in the ergosterol biosynthesis pathway, which is critical for membrane structure in fungi .

  • Fatty acid elongation: Cytochrome b5 provides electrons for fatty acid elongation reactions, potentially influencing the production of very long chain fatty acids (VLCFAs). These lipids are important components of sphingolipids and other complex membrane lipids in fungi.

  • Membrane domain organization: Through its effects on lipid composition, particularly ergosterol distribution, cytochrome b5 2 likely influences the formation and maintenance of specialized membrane domains. These domains are critical for organizing signaling complexes and membrane-associated processes.

  • Stress response modulation: Changes in membrane lipid composition mediated by cytochrome b5 activity may allow S. pombe to adapt to environmental stresses such as temperature shifts, oxidative damage, or chemical insults.

  • Cell cycle and cytokinesis: Lipid metabolism is tightly linked to cell cycle progression in S. pombe. While direct evidence for cytochrome b5 2 in this process is lacking, other components of S. pombe lipid metabolism have been implicated in cell division, suggesting potential indirect effects of cytochrome b5 function .

Experimental approaches to investigate these functions include lipidomic analysis of deletion mutants, membrane fluidity measurements, and synthetic lethal screens with genes involved in lipid biosynthesis pathways.

How does cytochrome b5 2 contribute to oxidative stress responses and redox homeostasis in S. pombe?

As an electron transfer protein with a redox-active heme group, cytochrome b5 2 likely plays significant roles in cellular redox processes:

  • Direct antioxidant functions: Cytochrome b5 may function as an electron donor in reactions that neutralize reactive oxygen species (ROS). Studies in mammalian systems have shown that overexpression of cytochrome b5 can reduce oxidative stress , suggesting a potential protective role in S. pombe.

  • Interaction with detoxification systems: Cytochrome b5 can donate electrons to various enzymes involved in xenobiotic metabolism and ROS detoxification. For example, it may modulate the activity of cytochrome P450 enzymes that metabolize toxic compounds, though specific P450-cytochrome b5 interactions in S. pombe remain to be characterized .

  • Regulation by iron availability: The observed regulation of cytochrome b5 2 by iron availability (2.2-2.5 fold change) suggests its integration into iron homeostasis networks. Iron metabolism and oxidative stress response are closely linked, as iron can catalyze ROS formation through Fenton chemistry.

  • Potential role during meiosis: S. pombe undergoes significant metabolic changes during meiosis, including altered redox conditions. While not directly demonstrated for cytochrome b5 2, other redox proteins like those encoded by the rec genes are essential for normal meiotic events , suggesting a potential framework where cytochrome b5 might contribute to meiotic redox balance.

  • Experimental approaches to investigate these functions:

    • Growth assays of deletion mutants under oxidative stress conditions (H₂O₂, paraquat, menadione)

    • Measurement of ROS levels in wild-type versus mutant cells using fluorescent probes

    • Transcriptomic analysis under oxidative stress conditions

    • Synthetic genetic interactions with known oxidative stress response genes

Understanding the role of cytochrome b5 2 in redox homeostasis has implications for fundamental cellular processes as well as potential biotechnological applications utilizing S. pombe as a production organism.

What are the potential roles of cytochrome b5 2 in S. pombe cell cycle regulation and meiotic processes?

While direct evidence specifically linking S. pombe cytochrome b5 2 to cell cycle regulation is limited, several indirect connections suggest potential involvement:

  • Cell cycle checkpoint modulation: Other components of electron transfer systems in S. pombe, including the RNA interference machinery proteins Ago1 and Dcr1, have been implicated in cell cycle checkpoint regulation independently of their RNAi functions . This suggests that electron transfer proteins like cytochrome b5 might similarly have moonlighting functions in cell cycle control.

  • Meiotic processes: Several genes involved in electron transfer are important for meiotic events in S. pombe. For instance:

    • The rec16 gene product is essential for normal meiotic replication, recombination, and gene expression

    • Meiotic recombination hot spots in S. pombe are associated with specific sequence motifs and chromatin states

    • Electron transfer proteins often show altered expression during meiosis

  • Cytokinesis regulation: Cell division requires extensive membrane remodeling, a process dependent on lipid metabolism. As cytochrome b5 contributes to lipid biosynthesis pathways, it may indirectly influence cytokinesis through effects on membrane composition .

  • Integration with signaling pathways: In S. pombe, the septation initiation network (SIN) regulates cytokinesis through proteins like Cdc11p that localize to the spindle pole body . While no direct link between cytochrome b5 and these pathways has been established, redox signaling is increasingly recognized as an important regulator of cell cycle events.

  • Experimental approaches to investigate these functions:

    • Cytological analysis of deletion mutants during mitosis and meiosis

    • Genetic interactions with known cell cycle regulators

    • Live cell imaging of tagged cytochrome b5 during the cell cycle

    • Analysis of replication timing and efficiency in mutant cells

    • Examination of meiotic recombination frequency in deletion mutants

Given that S. pombe serves as an excellent model for studying cell cycle regulation, with many conserved pathways relevant to human biology , further investigation of cytochrome b5's potential roles in these processes could yield insights applicable across eukaryotes.

How can synthetic biology approaches utilizing S. pombe cytochrome b5 2 be developed for biotechnological applications?

The electron transfer capabilities of cytochrome b5 2 present several opportunities for synthetic biology applications:

  • Engineered biosynthetic pathways:

    • Optimization of cytochrome b5 expression levels to enhance P450-dependent production of high-value compounds

    • Creation of synthetic electron transfer chains incorporating cytochrome b5 for novel biosynthetic reactions

    • Development of chimeric proteins combining the electron transfer domain of cytochrome b5 with other enzymatic functions

  • Biocatalysis applications:

    • Engineering S. pombe strains with modified cytochrome b5 for improved bioconversion of industrial precursors

    • Creation of whole-cell biocatalysts with enhanced electron transfer efficiency for stereoselective oxidation reactions

    • Development of immobilized enzyme systems incorporating cytochrome b5 for continuous bioprocessing

  • Biosensor development:

    • Using cytochrome b5's spectral properties to create redox-sensitive biosensors

    • Engineering fusion proteins with fluorescent reporters to monitor cellular redox states

    • Development of whole-cell biosensors for environmental monitoring applications

  • Methodological considerations:

    • Promoter optimization to achieve appropriate expression levels

    • Protein engineering to enhance stability and electron transfer efficiency

    • Integration of multiple genetic modifications to balance metabolic flux

    • Consideration of membrane topology and protein localization

The unique properties of S. pombe as a model organism, including its relatively simple growth requirements, genetic tractability, and eukaryotic cellular organization, make it particularly suitable for these biotechnological applications .

What are the most promising directions for future research on S. pombe cytochrome b5 2 and its cellular functions?

Several emerging research directions hold particular promise:

  • Systems biology integration:

    • Comprehensive mapping of the cytochrome b5 2 interactome using advanced proteomics

    • Integration of transcriptomic, proteomic, and metabolomic data to position cytochrome b5 2 in cellular networks

    • Development of predictive models for cytochrome b5 functions in different cellular contexts

  • Structural biology advances:

    • High-resolution structural determination of S. pombe cytochrome b5 2 in different redox states

    • Cryo-EM studies of cytochrome b5 in complex with partner proteins

    • Molecular dynamics simulations to understand electron transfer mechanisms

  • Single-cell analysis approaches:

    • Investigation of cell-to-cell variability in cytochrome b5 expression and function

    • Development of single-cell redox sensors to monitor cytochrome b5 activity in vivo

    • Correlation of cytochrome b5 levels with phenotypic heterogeneity in populations

  • Evolutionary and comparative studies:

    • Detailed analysis of cytochrome b5 variation across fungal species

    • Exploration of potential horizontal gene transfer events involving cytochrome b5 genes

    • Functional complementation studies across species boundaries

  • Translational research connections:

    • Investigation of S. pombe cytochrome b5 as a model for understanding human cytochrome b5-related disorders

    • Development of S. pombe screening platforms for modulators of cytochrome b5 function

    • Application of insights from S. pombe to agricultural fungal pathogens and their control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.