Recombinant Schizosaccharomyces pombe Probable endonuclease C19F8.04c (SPBC19F8.04c)

Shipped with Ice Packs
In Stock

Description

Overview of Schizosaccharomyces pombe

Schizosaccharomyces pombe, also known as fission yeast, is a species of yeast that is used in various biological studies . It is considered a valuable model organism for studying eukaryotic cellular processes, including DNA repair mechanisms . S. pombe shares more similarities with mammalian cells than Saccharomyces cerevisiae (budding yeast), especially in regulatory pathways .

DNA Repair Mechanisms in Schizosaccharomyces pombe

S. pombe possesses several enzymes involved in DNA repair, crucial for maintaining genomic stability. These enzymes include DNA glycosylases and AP endonucleases, which participate in base excision repair (BER) .

Key Enzymes in DNA Repair:

  • SpNth1: A homolog of E. coli endonuclease III, SpNth1 recognizes and removes damaged bases such as 5-formyluracil (5-foU) and 5-hydroxymethyluracil (5-hmU) from DNA . It also exhibits DNA glycosylase activity for removing 8-oxo-7,8-dihydroguanine (8-oxoG) .

  • Apn2p: The major AP endonuclease in S. pombe, Apn2p, functions by removing 3'-$$\alpha$$, $$\beta$$-unsaturated aldehyde ends induced by Nth1p .

  • Apn1p and Uve1p: Minor AP endonuclease activities are derived from Apn1p and Uve1p . Uve1p is a UV photoproduct-specific endonuclease that initiates an alternative excision repair pathway for UV-induced DNA damage .

Role of SpNth1 in Base Excision Repair

SpNth1 plays a significant role in the BER pathway by recognizing and removing oxidatively damaged bases from DNA . This enzyme exhibits broad substrate specificity, including activity against thymine glycol, 5-foU, 5-hmU, and 8-oxoG .

Substrate Specificity of SpNth1:

SubstrateSpecific Activity
5-Formyluracil (5-foU)Comparable
5-Hydroxymethyluracil (5-hmU)Comparable
Thymine GlycolComparable
8-oxo-7,8-dihydroguanine (8-oxoG)Demonstrated

The expression of SpNth1 reduces hydrogen peroxide toxicity and the frequency of spontaneous mutations in E. coli nth nei mutant, indicating its protective role against oxidative damage .

Uve1p and its Substrate Specificity

Uve1p, or ultraviolet DNA endonuclease, is involved in an alternative excision repair pathway for removing DNA damage caused by UV light . It cleaves 5' to UV light-induced cyclobutane pyrimidine dimers (CPDs) and pyrimidine-pyrimidone (6-4) photoproducts (6-4PP) . Uve1p can recognize a diverse range of UV-induced DNA photoproducts, including cis-syn-, trans-syn I- and trans-syn II CPDs, 6-4PP, and Dewar isomers . It also recognizes non-UV-induced DNA damage, such as platinum-DNA GG diadducts, uracil, dihydrouracil, and abasic sites .

Substrate Range of Uve1p:

SubstrateRecognized by Uve1p
cis-syn Cyclobutane Pyrimidine DimersYes
trans-syn I Cyclobutane Pyrimidine DimersYes
trans-syn II Cyclobutane Pyrimidine DimersYes
Pyrimidine-Pyrimidone (6-4) PhotoproductsYes
Dewar IsomersYes
Platinum-DNA GG DiadductsYes
UracilYes
DihydrouracilYes
Abasic SitesYes

AP Endonucleases Apn1 and Apn2

In S. pombe, Apn2p is the major AP endonuclease, differing from Saccharomyces cerevisiae where Apn1 provides the major activity . Inactivation of Apn2, but not Apn1, sensitizes S. pombe to alkylation and oxidative damage . Uve1 provides back-up APE activity along with Apn1 .

Schizosaccharomyces pombe in Gut Microbiome Studies

Schizosaccharomyces pombe has been identified in the gut microbiome of both healthy individuals and patients with colorectal cancer (CRC) . Proteomic studies have revealed distinctive sets of S. pombe proteins present in each group, suggesting a potential role of gut mycobiota in carcinogenesis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPBC19F8.04c; Probable endonuclease C19F8.04c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC19F8.04c
Target Protein Sequence
MQESQYKEKAIIGTGLITTSIGGFFFLRRFRRISNASTIPKNYLNNSTVENRKYKTMFGY VTRVGDGDNFRFYHTPGGRLLGWHWLRKVPCSRSDLSNETISVRLAGIDAPESAHFGKQE QPYALEAKEFLHNKLYHKSVRIIPLKIDRYARLVAGVQYYPIPHFFWKKDIGPQMIRKGL AVVYEGSDGVFCPTKKECLLALEIVAKKKKLSLWSQGKKLILPSVYKRGV
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is SPBC19F8.04c and what is its function in Schizosaccharomyces pombe?

SPBC19F8.04c is a protein-coding gene in the fission yeast Schizosaccharomyces pombe that encodes a nuclease enzyme. This probable endonuclease is characterized by its genomic location and predicted function based on sequence analysis. The specific function of SPBC19F8.04c remains to be fully characterized, but it likely belongs to a family of DNA endonucleases .

Similar endonucleases in S. pombe have been shown to recognize cyclobutane pyrimidine dimers and (6-4) pyrimidine-pyrimidone photoproducts, catalyzing ATP-independent incisions immediately 5' to the UV photoproduct and generating termini containing 3' hydroxyl and 5' phosphoryl groups . This suggests SPBC19F8.04c may play a role in DNA repair pathways, particularly in response to UV damage.

Gene DetailsInformation
Gene SymbolSPBC19F8.04c
Entrez Gene ID2540556
Full Namenuclease
Gene Typeprotein-coding
OrganismSchizosaccharomyces pombe (fission yeast)

How is SPBC19F8.04c different from other nucleases in S. pombe?

One distinguishing feature of SPBC19F8.04c is its regulatory pattern. Unlike many meiotic genes in S. pombe, SPBC19F8.04c lacks the U(U/C/G)AAAC motif that is characteristic of genes regulated by the RNA binding protein Mmi1 . Mmi1 is responsible for targeting meiosis-specific transcripts for degradation during vegetative growth.

In a study examining the Mmi1 regulon, researchers found that out of 31 genes, only SPBC19F8.04c and ubi4 did not contain this motif . Furthermore, SPBC19F8.04c is not regulated by Red1, another protein needed for the Mmi1 pathway. This suggests SPBC19F8.04c has a unique regulatory mechanism, potentially indicating a function that differs from typical meiosis-specific genes.

For experimental investigation of these differences, researchers would typically:

  • Perform comparative gene expression analysis across growth conditions

  • Generate knockout strains to observe phenotypic effects

  • Analyze promoter regions for unique regulatory elements

  • Conduct chromatin immunoprecipitation to identify transcription factor binding

What expression systems are available for producing recombinant SPBC19F8.04c?

Multiple expression systems are available for producing recombinant SPBC19F8.04c, each with distinct advantages depending on research needs :

Expression SystemProduct CodeAdvantagesConsiderations
YeastCSB-YP524596SXV1Native post-translational modifications, proper foldingLower yield than bacterial systems
E. coliCSB-EP524596SXV1High yield, cost-effectiveMay lack proper modifications
E. coli with Avi-tag BiotinylationCSB-EP524596SXV1-BBiotinylated in vivo for detection/immobilizationSpecialized application
BaculovirusCSB-BP524596SXV1Eukaryotic processing, higher expressionMore complex production
Mammalian cellCSB-MP524596SXV1Most authentic post-translational modificationsHigher cost, longer production time

The optimal expression system should be selected based on:

  • Required protein yield

  • Importance of post-translational modifications

  • Downstream applications (structural studies, enzymatic assays, etc.)

  • Budget constraints

  • Time considerations

What enzymatic assays can be adapted to measure SPBC19F8.04c activity?

While specific assays for SPBC19F8.04c are not detailed in the literature, several enzymatic assay approaches can be adapted from similar nuclease studies:

Fluorescence-Based Assays

A single-step functional analysis can be developed using fluorescent substrates . For nucleases, this often involves oligonucleotides with fluorophore-quencher pairs that generate measurable signals upon cleavage.

Methodology:

  • Design DNA substrates containing fluorophore at one end and quencher at the other

  • When intact, fluorescence is quenched

  • Upon cleavage by SPBC19F8.04c, separation of fluorophore from quencher produces measurable signal

  • Fluorescence intensity correlates with enzymatic activity

Two-Step Enzymatic Activity Assay

Following the approach used for iduronate-2-sulfatase , a two-step assay could be developed:

Methodology:

  • In the first step, SPBC19F8.04c cleaves a modified DNA substrate

  • The reaction is stopped with a specific buffer condition

  • In the second step, another enzyme reacts with the cleaved products to generate a detectable signal

  • Optimization of incubation times is critical (45-75 minutes for first step was optimal in the referenced study)

Calculating Enzymatic Units for Standardization

To standardize SPBC19F8.04c activity measurements:

  • Define an enzymatic unit (U) as the quantity of enzyme required to catalyze the conversion of one nanomole of substrate into product per minute (nmol/min) under defined conditions

  • Calculate the amount of product produced per minute through interpolation with a standard curve

  • This approach allows for quantitative comparison between different enzyme preparations

How can researchers assess SPBC19F8.04c's potential role in DNA repair?

To investigate SPBC19F8.04c's role in DNA repair, researchers should employ a multi-faceted approach:

Genetic Analysis

  • Generate SPBC19F8.04c deletion strains using homologous recombination

  • Assess sensitivity to various DNA-damaging agents (UV, ionizing radiation, chemical mutagens)

  • Perform genetic interaction studies to identify synthetic lethality with known DNA repair genes

  • Conduct complementation tests with site-directed mutants to identify critical residues

Biochemical Characterization

  • Perform in vitro nuclease assays using:

    • Undamaged DNA substrates

    • Substrates containing specific DNA lesions (UV photoproducts, abasic sites)

    • Various DNA structures (single-stranded, double-stranded, mismatched)

  • Determine reaction parameters:

    • ATP dependency (SPBC19F8.04c likely works in an ATP-independent manner)

    • Metal ion requirements

    • pH and temperature optima

    • Sequence specificity

Cellular Localization

  • Create fluorescently-tagged SPBC19F8.04c constructs

  • Monitor localization before and after DNA damage

  • Co-localize with known DNA repair markers

  • Assess recruitment kinetics to sites of damage

How does the absence of the U(U/C/G)AAAC motif in SPBC19F8.04c affect its regulation?

The absence of the U(U/C/G)AAAC motif in SPBC19F8.04c has significant implications for its regulation . This motif is found in genes regulated by the RNA-binding protein Mmi1, which targets meiotic transcripts for degradation during vegetative growth.

Methodological approaches to investigate this regulatory difference:

  • Comparative expression analysis:

    • Perform RNA-seq across different growth conditions and developmental stages

    • Compare SPBC19F8.04c expression profiles with known Mmi1-regulated genes

    • Design experiments to capture both transcriptional and post-transcriptional regulation

  • Reporter gene assays:

    • Create constructs with SPBC19F8.04c promoter and 3' UTR regions fused to reporter genes

    • Systematically mutate potential regulatory elements

    • Compare with constructs containing introduced U(U/C/G)AAAC motifs

  • RNA stability measurements:

    • Perform transcription inhibition time-course experiments

    • Measure mRNA half-life using quantitative RT-PCR

    • Compare stability in wild-type, mmi1 mutant, and red1 mutant backgrounds

  • Translational regulation analysis:

    • Use polysome profiling to assess translational efficiency

    • Calculate translational scores using the method described in search result :

      • Multiply the percentage in each fraction with arbitrary weights (1, 2, 3, and 4)

      • Sum the results to obtain a translational score

      • Compare scores between different conditions

What computational approaches can predict SPBC19F8.04c substrate specificity?

Bioinformatics approaches can provide valuable insights into SPBC19F8.04c substrate specificity before experimental validation :

Sequence-Based Analysis

  • Multiple sequence alignment of SPBC19F8.04c with characterized nucleases

  • Identification of conserved catalytic residues and substrate-binding domains

  • Analysis of amino acid composition in putative DNA-binding regions

  • Prediction of secondary structure elements associated with substrate recognition

Structural Modeling

  • Generate homology models using related nucleases as templates

  • Perform molecular docking with various DNA substrates

  • Simulate enzyme-substrate interactions using molecular dynamics

  • Calculate binding energies to predict preferred substrates

Machine Learning Approaches

  • Train models on known nuclease-substrate datasets

  • Identify sequence and structural features that correlate with specificity

  • Use these models to predict SPBC19F8.04c cleavage sites in genomic DNA

  • Validate predictions with experimental methods

How can batch-to-batch variability in recombinant SPBC19F8.04c production be assessed?

Quality control and batch consistency are critical for research reproducibility. Based on methodologies described for other enzymes , researchers can:

  • Implement fluorescence nanoparticle tracking analysis (F-NTA):

    • Stain preparations with lipophilic fluorescent dyes like Di-8-ANEPPS

    • Discriminate between properly folded protein and non-functional aggregates

    • Compare particle concentration and size distribution between batches

  • Develop standardized functional assays:

    • Create a reference standard from a well-characterized batch

    • Determine the detection limit (lowest concentration giving signal above background)

    • Establish acceptance criteria for specific activity

  • Create a comprehensive quality control panel:

QC ParameterMethodAcceptance Criteria
PuritySDS-PAGE, Western blot>90% purity
Protein concentrationBradford/BCA assayWithin 10% of specification
Enzymatic activityFluorescence-based assay>80% of reference standard
AggregationDynamic light scattering<10% aggregates
Endotoxin levelLAL test<0.1 EU/μg protein
StabilityActivity retention at 4°C/7 days>90% activity retention

How should experiments be designed to study SPBC19F8.04c in the context of gene regulatory networks?

To understand SPBC19F8.04c within broader gene networks, researchers can adapt the multiple-probe experimental design described for the PEAK Relational Training System :

Methodology:

  • Baseline probes:

    • Establish baseline expression of SPBC19F8.04c across different conditions

    • Identify factors that naturally alter expression

  • Temporal staggering:

    • Introduce perturbations (genetic, environmental) at defined intervals

    • Monitor changes in SPBC19F8.04c expression and activity

    • Track co-regulated genes to build network connections

  • Mastery criteria:

    • Define clear experimental endpoints

    • Establish quantitative thresholds for determining significant effects

    • Implement programming adjustments when experiments fail to meet criteria

  • Field testing:

    • Validate findings across different strain backgrounds

    • Test predictions in related yeast species

    • Apply findings to practical applications in DNA repair or genome manipulation

What are the common challenges in establishing reliable enzymatic assays for SPBC19F8.04c and how can they be overcome?

Based on experiences with other enzymatic assays , researchers commonly encounter these challenges:

  • Inhibition by reaction products:

    • In coupled enzyme assays, accumulation of products like NADPH can inhibit the secondary enzyme

    • Solution: Include scavenging systems or optimize reaction times to prevent product buildup

  • Determination of optimal incubation times:

    • Too short: incomplete reaction and poor sensitivity

    • Too long: substrate depletion and loss of linearity

    • Solution: Perform time-course experiments (45-75 minutes found optimal for similar two-step assays)

  • Selection of appropriate detection methods:

    • Different substrates require specific detection strategies

    • Solution: Compare fluorescence, absorbance, and coupled enzyme approaches

  • Data analysis challenges:

    • Translating raw data into meaningful activity measurements

    • Solution: Adapt analytical approaches from similar enzymes, such as:

      • Calculating the sum of total differences between profiles under different conditions

      • Developing translational scores by weighting different fractions

      • Using visual inspection alongside automated methods to curate results

How can researchers develop specific inhibitors for SPBC19F8.04c?

Development of specific inhibitors requires a systematic approach:

  • Structure-based design:

    • Generate homology models of SPBC19F8.04c

    • Identify druggable pockets within the catalytic site

    • Design compounds that interact with catalytic residues

    • Perform in silico screening of compound libraries

  • High-throughput screening:

    • Adapt the fluorescence-based enzymatic assays to microplate format

    • Screen diverse chemical libraries

    • Establish robust positive and negative controls

    • Calculate Z' factor to ensure assay quality

  • Validation cascade:

StageAssay TypePurposeCriteria for Advancement
Primary ScreenSingle-concentration fluorescent assayIdentify initial hits>50% inhibition
Dose-ResponseSerial dilution, same assayDetermine potencyIC50 <10 μM
Orthogonal AssayDifferent detection methodConfirm mechanismConsistent potency
SelectivityTesting against related nucleasesAssess specificity>10-fold selectivity
Cellular ActivityS. pombe growth/repair assaysConfirm cell permeabilityActivity in cellular context
  • Optimization strategy:

    • Focus on compounds with favorable physicochemical properties

    • Perform structure-activity relationship studies

    • Balance potency with selectivity and cell permeability

    • Consider computational methods to predict off-target effects

What approaches should be used to analyze SPBC19F8.04c enzymatic activity data?

Data analysis for enzymatic assays should follow rigorous protocols:

  • Quality control of raw data:

    • Establish detection limits (found to be ~6×10^8 particles/ml in similar assays)

    • Include appropriate controls in each experiment

    • Check for linearity within the working range

  • Calculation of enzymatic parameters:

    • Determine substrate concentration relative to Km (typically 6-fold higher than Km is recommended)

    • Express activity in standardized enzymatic units (U): nmol substrate converted per minute

    • Calculate specific activity (U/mg protein)

  • Statistical analysis:

    • For translational profiling data, use specialized approaches:

      • Sum the total difference between profiles for each fraction

      • Calculate translational scores by multiplying percentages in each fraction with arbitrary weights

      • Determine translational ratios by dividing stress condition scores by control scores

  • Data visualization:

    • Plot enzyme kinetics using standard Michaelis-Menten or Lineweaver-Burk representations

    • For complex data sets, consider adapting the visual inspection approach mentioned in result

    • Use appropriate statistical tests (ANOVA for comparing multiple conditions)

How can SPBC19F8.04c research be integrated with broader bioinformatics approaches?

Integrating SPBC19F8.04c research with bioinformatics enables more comprehensive understanding:

  • Comparative genomics:

    • Identify SPBC19F8.04c homologs across species

    • Analyze evolutionary conservation of catalytic domains

    • Map sequence variations to functional differences

  • Transcriptomics integration:

    • Correlate SPBC19F8.04c expression with global gene expression patterns

    • Identify co-regulated genes under various conditions

    • Construct gene regulatory networks

  • Proteomics data integration:

    • Identify post-translational modifications affecting activity

    • Map protein-protein interaction networks

    • Analyze subcellular localization patterns

  • Pathway analysis:

    • Place SPBC19F8.04c in the context of DNA repair pathways

    • Model the impact of SPBC19F8.04c mutations on pathway efficiency

    • Predict synthetic lethal interactions based on pathway redundancy

  • Machine learning applications:

    • Train models to predict SPBC19F8.04c activity based on substrate features

    • Use natural language processing to extract SPBC19F8.04c-related information from literature

    • Develop prediction algorithms for functional consequences of mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.