Recombinant Schizosaccharomyces pombe Probable metal homeostasis protein bsd2 (bsd2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its implementation.
Synonyms
bsd1; bsd2; SPAC328.07c; Probable metal homeostasis protein bsd1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
bsd1
Target Protein Sequence
MSTNSNQNSIHTPIPEFPENRSTNRSELAAAFEPPDDDVEYSETAPLYSSARASIEGEEA FYQHLSTPDPGNDSGHVRSSNDRIPSTSSNHADGHHVDSVFSNLSAKPTVESNTEELEEE PPSYEQAAADTAPPYWDTTMVIPDYGSNEIYIDGMSVGTGFSFVWSACVAILFPFVGFLV TYVLSTTHLGRYGAQIGLSLTLFQRGYIMISESGMENNDDQYNYDELPHQKLIGSILIII GWCLVLVDTFGFIRIRRMKNAISRTDSPGETSPEEVV
Uniprot No.

Target Background

Function
Essential for maintaining homeostasis of heavy metal ions, including cadmium, cobalt, and copper.
Database Links
Protein Families
BSD2 family
Subcellular Location
Endoplasmic reticulum. Vacuole. Membrane; Multi-pass membrane protein.

Q&A

What is the bsd2 protein and what is its predicted role in S. pombe metal homeostasis?

Bsd2 in Schizosaccharomyces pombe is classified as a probable metal homeostasis protein that likely functions within the broader network of proteins involved in metal ion regulation. While the specific function remains under investigation, evidence suggests it may play a role similar to other metal homeostasis proteins in S. pombe such as those involved in the endoplasmic reticulum (ER) processing of metal transporters. S. pombe serves as an excellent model organism for metal homeostasis studies because, unlike Saccharomyces cerevisiae, it employs phytochelatin-dependent pathways for metal detoxification similar to those found in plants . The bsd2 protein likely contributes to the sophisticated metal regulation system that involves sequestration, transport, and detoxification of various metal ions.

How does S. pombe metal homeostasis research inform our understanding of similar processes in plants?

S. pombe represents a powerful model system for plant metal homeostasis because both organisms share the phytochelatin (PC) synthesis pathway as a primary detoxification mechanism. Unlike S. cerevisiae, which relies mainly on glutathione for cadmium detoxification, S. pombe utilizes phytochelatins synthesized from glutathione by phytochelatin synthase (PCS), creating a system remarkably similar to that in plant cells . This similarity extends to the transport of PC-metal complexes into vacuoles and the formation of high molecular weight (HMW) complexes for stable sequestration . Studying proteins like bsd2 in S. pombe can therefore provide valuable insights into equivalent processes in plants while offering the experimental advantages of a unicellular eukaryote with a fully sequenced genome and established molecular tools .

What are the primary metals that S. pombe homeostasis proteins typically interact with?

S. pombe homeostasis proteins typically interact with both essential and toxic metals. Based on research with related proteins, these include:

Metal TypeExamplesObserved Interactions
EssentialZinc (Zn²⁺), Copper (Cu), Iron (Fe²⁺)Transport, storage, regulation
ToxicCadmium (Cd²⁺), Arsenic (AsO₄³⁻, AsO₂⁻), Mercury (Hg)Detoxification, sequestration

Studies have demonstrated that cadmium ions often enter S. pombe cells via transporters intended for essential metals like iron, zinc, or calcium . Once inside the cell, detoxification mechanisms involving phytochelatins are activated. The resulting PC-Cd complexes are transported into the vacuole by ABC-type transporters such as Hmt1 . It's likely that bsd2, as a metal homeostasis protein, interacts with one or more of these metals or their transport systems, potentially in coordination with the phytochelatin pathway.

What expression systems are most effective for producing recombinant S. pombe bsd2 protein?

For the expression of recombinant S. pombe bsd2, researchers should consider several expression systems based on the protein's predicted characteristics and research requirements:

When designing expression constructs, consider incorporating affinity tags (His6, GST, or MBP) to facilitate purification, while ensuring these tags don't interfere with the protein's metal-binding properties. Validation of proper folding and activity should follow purification, potentially using metal-binding assays appropriate to the predicted function of bsd2.

What analytical methods are most suitable for characterizing bsd2-metal interactions?

For characterizing bsd2-metal interactions, researchers should employ complementary analytical approaches:

TechniqueApplicationAdvantagesLimitations
ICP-MSQuantitative metal bindingHigh sensitivity, multi-elemental analysisDestructive, no structural information
SEC-ICP-MSMetal association with protein fractionsLinks metal content to protein size/stateLimited resolution
Isothermal Titration CalorimetryBinding constants, thermodynamicsDirect measurement of binding parametersRequires significant protein amounts
X-ray Absorption SpectroscopyMetal coordination environmentProvides atomic-level structural informationLimited accessibility, specialized equipment
Proximity Labeling (TurboID)Protein interaction partnersIdentifies proteins in close proximityMay capture transient interactions

When designing experiments to study bsd2-metal interactions, researchers should first identify the specific metals of interest based on the protein's predicted function. The experimental design should include appropriate controls to distinguish specific from non-specific metal binding. For instance, creating point mutations in predicted metal-binding residues can provide valuable comparative data. Additionally, conducting experiments under varying metal concentrations and oxidation states can reveal the protein's behavior under different physiological conditions.

How can researchers verify the functional activity of recombinant bsd2?

Verifying the functional activity of recombinant bsd2 requires multiple complementary approaches:

  • Genetic complementation: Express recombinant bsd2 in bsd2-deficient S. pombe strains (∆bsd2) and assess the restoration of metal homeostasis phenotypes. This approach has proven effective for other metal homeostasis genes in S. pombe, such as the demonstration that Zym1 overexpression can partially rescue zinc hypersensitivity in ∆zhf cells .

  • Metal sensitivity assays: Compare the growth of wild-type, ∆bsd2, and complemented strains in media containing varying concentrations of metals. Similar approaches have been used to characterize other S. pombe metal homeostasis proteins, as demonstrated for zhf and zym1 . Growth curves in liquid culture as well as spot tests on solid media with different metal concentrations can reveal subtle phenotypic differences.

  • Subcellular localization: Determine whether the recombinant protein localizes correctly within the cell using fluorescent protein tags or immunofluorescence. Proper localization is often critical for function, as demonstrated for the zinc transporter Zhf, which localizes to the endoplasmic reticulum in S. pombe .

  • Metal content analysis: Measure cellular metal content using inductively coupled plasma mass spectrometry (ICP-MS) in wild-type versus mutant strains, with and without recombinant protein expression. This can reveal whether bsd2 affects the accumulation or distribution of specific metals.

How might bsd2 interact with the phytochelatin-dependent detoxification pathway?

The potential interaction between bsd2 and the phytochelatin (PC) pathway likely depends on bsd2's specific function in metal homeostasis. Several possibilities exist:

  • Metal ion delivery/sequestration: Bsd2 might function upstream of the PC pathway by influencing the bioavailability of metal ions that activate phytochelatin synthase (PCS). Studies in S. pombe have shown that PC synthesis is activated by metal ions, particularly Cd²⁺ . If bsd2 regulates the cytosolic concentration of these activating metals, it could indirectly modulate PC synthesis.

  • Transporter regulation: Based on the role of related proteins in other organisms, bsd2 might regulate metal transporters through ER-associated processing or degradation. In S. pombe, the transport of PC-Cd complexes into the vacuole is mediated by the ABC-type transporter Hmt1 . If bsd2 influences the expression, trafficking, or activity of such transporters, it could affect the efficiency of PC-mediated detoxification.

  • Sulfur metabolism connection: The PC pathway depends on glutathione, which requires sulfur amino acids for its synthesis. If bsd2 plays a role in sulfur metabolism or trafficking (similar to the role of Hmt2 in S. pombe ), it might indirectly affect PC synthesis.

To experimentally test these hypotheses, researchers could analyze PC levels and complex formation in ∆bsd2 mutants compared to wild-type cells under metal stress conditions. Additionally, genetic interaction studies between bsd2 and known PC pathway components (pcs, hmt1) could reveal functional relationships.

What is the potential relationship between bsd2 and other characterized metal transporters in S. pombe?

The potential relationship between bsd2 and other S. pombe metal transporters likely involves regulatory interactions rather than direct physical associations. Based on studies of metal homeostasis networks in S. pombe, several relationships are possible:

  • Relationship with Zhf (zinc transporter): Zhf is a cation diffusion facilitator (CDF) that transports zinc into the endoplasmic reticulum in S. pombe and affects both zinc and cadmium tolerance . If bsd2 functions as a regulator of metal transporters, it might affect Zhf stability, trafficking, or activity. Researchers could investigate this by examining Zhf protein levels, localization, and activity in ∆bsd2 strains.

  • Interaction with Hmt1 (PC-Cd complex transporter): Hmt1 is an ABC-type transporter that mediates the transport of PC-Cd complexes into the vacuole . Bsd2 might affect Hmt1 function through direct or indirect mechanisms. Studying the formation of high molecular weight (HMW) Cd complexes in ∆bsd2 mutants could reveal whether vacuolar sequestration via Hmt1 is affected.

  • Connection to CAX transporters: S. pombe contains a homolog of plant CAX (calcium exchanger) transporters (gene SPCC1795.02c), though its disruption does not affect cadmium sensitivity . Bsd2 might have regulatory interactions with this or other ion exchangers that contribute to metal homeostasis.

Experimental approaches to explore these relationships could include co-immunoprecipitation, proximity labeling techniques like TurboID (which has been successfully applied to other S. pombe proteins ), and genetic interaction studies (synthetic lethality or suppression screens).

How does the function of bsd2 compare to similar proteins in other model organisms?

While specific information about bsd2 in S. pombe is limited in the provided search results, we can make informed comparisons to similar proteins in other organisms:

OrganismSimilar ProteinFunctionKey Differences from S. pombe
S. cerevisiaeBsd2Regulates metal transporters through ER-associated degradationLacks PC pathway, relies on GSH and YCF1
Plants (A. thaliana)CCCH-type zinc finger proteinsMetal homeostasis regulationMore complex multicellular system
MammalsNEDD4 family interacting proteinsRegulates metal transporters through ubiquitinationMore specialized tissue-specific regulation

Plants contain various metal homeostasis regulators, including zinc finger proteins that respond to metal status. The S. pombe system, including proteins like bsd2, represents a simplified model that shares key features with plant systems, particularly the reliance on phytochelatins for metal detoxification .

What are the implications of bsd2 research for understanding metal-related disorders in higher organisms?

Research on S. pombe bsd2 has significant implications for understanding metal-related disorders in higher organisms through several pathways:

  • Molecular mechanisms of metal toxicity: S. pombe studies have revealed that cadmium toxicity partially works through disruption of zinc homeostasis, with Cd²⁺ treatment eliciting responses similar to zinc deficiency . Understanding how bsd2 functions within this system could provide insights into similar mechanisms in higher organisms, where disrupted metal homeostasis contributes to conditions like neurodegenerative diseases, where metal misregulation is implicated.

  • Detoxification pathway conservation: The phytochelatin pathway, central to S. pombe metal detoxification, has components conserved in animals, including humans. For example, phytochelatin synthase homologs have been identified in the model ascidian Ciona intestinalis . If bsd2 interacts with this pathway, insights from S. pombe could inform our understanding of related processes in higher organisms.

  • Therapeutic target identification: Identifying how bsd2 regulates metal homeostasis could reveal new therapeutic targets for metal-related disorders. The use of S. pombe as a model system allows for rapid genetic manipulation and screening approaches that would be more challenging in mammalian systems.

Researchers exploring these implications should consider employing comparative genomics approaches to identify human homologs of bsd2 and related S. pombe proteins, followed by functional validation in appropriate mammalian cell models.

What cutting-edge techniques can advance our understanding of bsd2 structure-function relationships?

Several cutting-edge techniques can significantly advance our understanding of bsd2 structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM): This technique can reveal the three-dimensional structure of bsd2 alone or in complex with interaction partners without the need for crystallization. Recent advances in resolution make this particularly valuable for membrane-associated proteins that are often difficult to crystallize.

  • AlphaFold2/RoseTTAFold: These AI-based protein structure prediction tools can provide high-confidence structural models of bsd2, especially useful when combined with experimental validation. These models can identify potential metal-binding sites and interaction interfaces.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can reveal dynamic aspects of protein structure and conformational changes upon metal binding or protein-protein interactions, providing insights into how bsd2 functions mechanistically.

  • Proximity labeling proteomics: Methods like TurboID, which has been successfully applied to other S. pombe proteins , can identify proteins that interact with or function near bsd2 in living cells. This approach is particularly valuable for identifying transient interactions that might be missed by traditional co-immunoprecipitation approaches.

  • Single-molecule techniques: Techniques such as single-molecule FRET can reveal conformational dynamics of bsd2 in response to metal binding or protein interactions, providing insights into the molecular mechanisms of its function.

Implementation of these techniques requires careful experimental design, including the generation of functional tagged versions of bsd2 that maintain native activity, as has been demonstrated for other S. pombe proteins .

How might environmental factors influence bsd2 function in metal homeostasis?

Environmental factors likely play significant roles in modulating bsd2 function within the metal homeostasis network of S. pombe. Several important considerations include:

  • pH fluctuations: Metal bioavailability and transporter activity are highly pH-dependent. Changes in environmental pH could alter the metal specificity of transporters regulated by bsd2, similar to how pH affects other components of metal homeostasis systems. Experimental approaches should include testing bsd2 function across physiologically relevant pH ranges.

  • Oxidative stress: Metal toxicity often involves generation of reactive oxygen species (ROS). Research in S. pombe has shown connections between metal homeostasis and oxidative stress responses. For instance, the mitochondrial sulfide dehydrogenase Hmt2 affects cadmium tolerance through regulation of sulfide levels . Bsd2 function might similarly be modulated by oxidative conditions, which could be tested by examining bsd2 mutant phenotypes under combined metal and oxidative stress.

  • Nutrient availability: The availability of essential metals affects the expression and function of metal homeostasis systems. In S. pombe, zinc transporter Zhf is important for growth under both zinc excess and zinc-limited conditions . Bsd2 function might similarly be influenced by the environmental availability of various metals, requiring experimental testing across a range of metal concentrations.

  • Temperature: As with many biological processes, metal homeostasis systems are temperature-sensitive. Researchers should consider whether bsd2 function varies with temperature, particularly in the context of stress responses where temperature fluctuations might coincide with other stressors.

To systematically investigate these environmental influences, researchers could employ transcriptomics and proteomics approaches to compare wild-type and bsd2 mutant responses to various environmental conditions, potentially revealing condition-specific roles for bsd2 in metal homeostasis.

What are the most promising directions for bsd2 research in understanding plant metal homeostasis?

Future research on S. pombe bsd2 offers several promising avenues for enhancing our understanding of plant metal homeostasis:

  • Comparative functional analysis: Identifying and characterizing plant homologs of bsd2 could reveal conserved mechanisms of metal transporter regulation. This approach would benefit from leveraging S. pombe as a model system to first establish fundamental principles that can then be tested in more complex plant systems.

  • Integration with phytochelatin pathway: Exploring how bsd2 interacts with the phytochelatin-dependent detoxification pathway could provide insights into the regulation of this crucial metal detoxification system in plants. Research has established that this pathway is essential for cadmium tolerance in both S. pombe and plants , making it a particularly relevant area of investigation.

  • Metal specificity studies: Determining whether bsd2 shows preferential activity toward specific metals could inform our understanding of metal-specific regulation in plants. Research in S. pombe has shown that different metals engage distinct detoxification pathways, with the phytochelatin pathway being dominant for cadmium .

  • Stress adaptation mechanisms: Investigating how bsd2 function adapts to changing metal availability could reveal mechanisms of stress adaptation relevant to plant survival under variable environmental conditions. This is particularly relevant as climate change affects soil metal content and bioavailability.

  • Systems biology approach: Integrating bsd2 into broader models of metal homeostasis networks could provide a more comprehensive understanding of how plants maintain metal balance. S. pombe offers advantages for systems biology approaches due to its relatively simpler genome while maintaining key features of eukaryotic metal homeostasis .

What technological challenges must be overcome to fully characterize the bsd2 interactome?

Fully characterizing the bsd2 interactome presents several technological challenges that researchers must address:

  • Membrane protein interactions: If bsd2 associates with membranes, as do many metal homeostasis proteins in S. pombe (such as Zhf localized to the ER ), traditional interaction methods like yeast two-hybrid may be ineffective. Alternative approaches such as membrane yeast two-hybrid or split-ubiquitin systems would be more appropriate.

  • Transient interactions: Regulatory interactions involving bsd2 may be transient and condition-dependent. Capturing these interactions requires techniques like in vivo crosslinking or proximity labeling methods such as TurboID, which has been successfully applied to other S. pombe proteins . These methods can identify proteins in close proximity even if their interactions are brief.

  • Metal-dependent interactions: The presence of specific metals may trigger or disrupt bsd2 interactions. Interaction studies should therefore be conducted under various metal conditions. Specialized metal-tolerant versions of interaction assays may need to be developed to handle potentially toxic metal concentrations.

  • Distinguishing direct from indirect interactions: Network analysis must differentiate between direct physical interactions and functional associations. Combinatorial approaches using multiple interaction detection methods with different principles can help establish confidence levels for each interaction.

  • Computational challenges in network analysis: Integrating interactome data with other -omics datasets requires sophisticated computational approaches. Machine learning and network analysis algorithms can help identify patterns and key nodes in the bsd2-centered network, but require careful validation.

To overcome these challenges, researchers should consider employing complementary approaches and developing new methodologies specifically tailored to metal homeostasis proteins.

How might genetic variation in bsd2 influence metal tolerance phenotypes across S. pombe strains?

Natural genetic variation in bsd2 across S. pombe strains could significantly influence metal tolerance phenotypes through several mechanisms:

  • Altered metal specificity: Amino acid substitutions in metal-binding domains could shift the metal preference of bsd2, potentially enhancing tolerance to specific metals while reducing tolerance to others. This phenomenon has been observed with other metal homeostasis proteins, where subtle structural changes can dramatically alter metal selectivity.

  • Expression level differences: Promoter or regulatory region variants could affect bsd2 expression levels, timing, or responsiveness to environmental cues. Research on other S. pombe metal homeostasis genes has shown that expression levels can significantly impact metal tolerance .

  • Protein-protein interaction changes: Variants that affect interaction surfaces could alter bsd2's ability to engage with other components of the metal homeostasis network, potentially modifying its regulatory impact on the system.

  • Subcellular localization differences: Mutations affecting targeting sequences could alter bsd2 localization within the cell, potentially redirecting its activity to different compartments with consequent effects on metal tolerance.

To investigate these possibilities, researchers could employ:

  • Genome-wide association studies across diverse S. pombe isolates, correlating bsd2 sequence variants with metal tolerance phenotypes

  • Targeted mutagenesis of bsd2 to create and characterize variant alleles

  • Allele replacement experiments to confirm the phenotypic effects of natural variants

These approaches could not only reveal the functional significance of bsd2 genetic diversity but also provide insights into natural adaptation mechanisms to varying metal environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.