Recombinant Schizosaccharomyces pombe Probable mitochondrial chaperone bcs1 (SPAC644.07)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAC644.07; Probable mitochondrial chaperone bcs1; BCS1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC644.07
Target Protein Sequence
MDNIGAADAATSSGISGLLSGNSFLGAGIGLMGFGAGLAILRRGLISGASLVKRRMLVSV EIPSKEKSYNAFLHWMSTVPKRYSNQLAVESNRQLKMPQNAREKPDKQVANRIFSLVPGP GKHYIKYKKCWIQVERERSNRLQDLTTGTPWETITLTTLSRDRGIFSELLLEAQKFMQSA QKNKTTIYTAWATEWKPFGHPRSKRMLSSVVLESNVKKMITDDVHDFLRNSQWYDTRGIP YRRGYLLYGPPGSGKTSFLYALAGELDYDICVLNLAEKGLTDDRLNHLLSNVPPKAVVLL EDVDSAFQGRERSGEVGFHANVTFSGLLNALDGVTSSDERIIFMTTNHPEKLDPALVRPG RVDVKAYLGNATPEQVREMFTRFYGHSPEMADDLSDIVCPKNTSMASLQGLFVMNKSSPA DAVDMAKELPDNPPSTPFSFNVHRKSLSV
Uniprot No.

Target Background

Function
A chaperone protein essential for the assembly of mitochondrial respiratory chain complex III.
Database Links
Protein Families
AAA ATPase family, BCS1 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the basic function and classification of mitochondrial chaperone Bcs1?

Bcs1 is a homo-heptameric transmembrane AAA-ATPase (ATPases Associated with diverse cellular Activities) that facilitates the translocation of folded Rieske iron-sulfur protein across the inner mitochondrial membrane. It belongs to the superfamily of AAA proteins, which are ring-shaped homo-oligomeric ATPases involved in numerous cellular activities including protein unfolding and degradation, DNA replication, and membrane fusion . Unlike typical soluble AAA proteins that form hexamers, Bcs1 forms a unique homo-heptameric transmembrane structure, making it particularly interesting for researchers studying mitochondrial protein transport mechanisms .

What is the structural organization of Bcs1 protein?

Bcs1 has a distinctive structural organization consisting of:

  • A large C-terminal domain containing a Bcs1-specific domain and a nucleotide binding domain

  • A matrix-facing cavity approximately 40 Å in diameter and 40 Å deep in the apo conformation

  • A conical cavity in the transmembrane domain (TMD)

  • Seven transmembrane helices (TMHs) arranged in a basket-shaped structure that forms the TMD cavity in the apo/ADP conformation

This structural arrangement creates a unique protein transport mechanism where the folded substrate protein is loaded into the matrix cavity and then translocated through the TMD cavity upon ATP binding and hydrolysis .

What are the different conformational states of Bcs1?

Bcs1 exhibits three distinct conformational states depending on the nucleotide bound:

These conformational changes are critical to understanding how the protein functions in translocating substrate proteins across the membrane.

What are the optimal storage and handling conditions for recombinant Bcs1 protein?

For optimal results when working with recombinant Schizosaccharomyces pombe Probable mitochondrial chaperone Bcs1, researchers should follow these guidelines:

  • Store the protein at -20°C for general storage

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles as this can compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability

These storage conditions ensure the maintenance of protein structure and function for experimental applications.

How should researchers design experiments to study the ATPase cycle of Bcs1?

When designing experiments to study the ATPase cycle of Bcs1, researchers should consider:

  • Comparative analysis of the protein in different nucleotide states (apo, ADP-bound, and ATP-bound)

  • Implementation of high-speed atomic force microscopy (HS-AFM) to detect conformational changes in real-time

  • Time-resolved measurements to capture the kinetics of the conformational changes

  • Control experiments with non-hydrolyzable ATP analogs (like ATPγS) to isolate binding-induced conformational changes from hydrolysis-induced changes

  • Single-molecule techniques to observe individual ATPase cycles

For measuring the speed of conformational coupling between subunits, researchers should design experiments with time resolution better than 270 μs, as this has been established as the upper limit for conformational coupling in the concerted power stroke mechanism of Bcs1 .

What methods can be used to express and purify recombinant Bcs1 for structural studies?

For high-quality protein preparation suitable for structural studies:

  • Express the full-length protein (amino acids 1-449) in an appropriate expression system

  • Consider using the Schizosaccharomyces pombe strain 972/ATCC 24843 (Fission yeast) as the source organism

  • Include appropriate affinity tags for purification (the tag type may be determined during the production process)

  • Use a Tris-based buffer with 50% glycerol for final protein storage

  • Verify protein quality using SDS-PAGE and Western blotting with antibodies against the protein or tag

  • Confirm protein folding and activity through functional assays measuring ATPase activity

The amino acid sequence provided in the product information can be used to design appropriate expression constructs: MDNIGAADAATSSGISGLLS... (full sequence available in product documentation) .

How does the concerted ATPase cycle of Bcs1 differ from other AAA-ATPases?

The concerted ATPase cycle of Bcs1 represents a significant departure from the typical mechanism observed in other AAA-ATPases:

  • Heptameric vs. Hexameric Structure: Unlike typical soluble AAA proteins that form hexamers, Bcs1 forms a homo-heptameric structure .

  • Concerted vs. Sequential Mechanism: While many AAA+ proteins operate through a sequential "hand-over-hand" mechanism with different nucleotide states present in different subunits simultaneously, Bcs1 appears to function through a concerted mechanism where conformational changes propagate rapidly (< 270 μs) throughout the heptameric ring .

  • Conformational Uniformity: In Bcs1, all subunits maintain the same conformation in a given nucleotide state, rather than adopting a staircase-like configuration with mixed nucleotide states .

  • Membrane Integration: As a transmembrane protein, Bcs1's mechanism must account for interactions with the lipid bilayer, adding complexity not present in soluble AAA-ATPases .

This unique mechanism suggests specialized adaptation for translocating folded proteins across membranes, distinguishing it from AAA-ATPases involved in protein unfolding and degradation.

What is the energetic cost of TMH opening during the Bcs1 transport cycle?

The energetic cost of transmembrane helix (TMH) opening during the Bcs1 transport cycle can be estimated using membrane deformation calculations:

The total deformation free energy (ΔG₍ₜₒₜₐₗ₎) associated with TMH opening can be expressed as:

ΔG₍ₜₒₜₐₗ₎ = G₍ₘᵢₛₘₐₜ𝒸ₕ₊ᵣₐ𝒹ᵢᵤₛ₎ + G₍ₜᵢₗₜ₎

Where:

  • G₍ₘᵢₛₘₐₜ𝒸ₕ₊ᵣₐ𝒹ᵢᵤₛ₎ accounts for compression and bending energy

  • G₍ₜᵢₗₜ₎ represents the tilt energy

The compression and bending energy can be calculated using:

G₍ₘᵢₛₘₐₜ𝒸ₕ₊ᵣₐ𝒹ᵢᵤₛ₎ is dependent on:

  • u(α): half of the mismatch between protein and bilayer hydrophobic regions

  • κ: bilayer bending modulus (~14 k₍B₎T)

  • λ: mismatch decay length (~1.1 nm)

  • r: protein radius (~2 nm for apo state Bcs1 IMS face)

The tilt energy component involves:

  • c: spontaneous curvature (c₍₀₎ ≈ 1/(10r))

  • θ: membrane slope (= 90-α)

Researchers can generate a plot of the total energy change between open and closed states as a function of angle α to determine the energetic barriers that must be overcome during the transport cycle .

How do mutations in the SPAC644.07 gene affect Bcs1 function?

While specific mutation studies of the SPAC644.07 gene in S. pombe are not detailed in the provided references, researchers can design mutation studies based on conservation patterns and functional domains:

  • Nucleotide Binding Domain Mutations: Mutations in the conserved Walker A and Walker B motifs would likely abolish ATPase activity and subsequent conformational changes.

  • Transmembrane Domain Mutations: Alterations in the basket-shaped TMD structure could affect substrate passage through the membrane.

  • Interface Mutations: Modifications at subunit interfaces could disrupt the concerted conformational changes essential for function.

  • Substrate Recognition Site Mutations: Changes to regions involved in recognizing the Rieske iron-sulfur protein would impair substrate specificity.

Researchers should compare sequence conservation between S. pombe Bcs1 and homologs in other organisms, particularly focusing on residues that align with known pathogenic mutations in human BCS1L, which is associated with mitochondrial disorders .

How can researchers analyze time-resolved conformational changes in Bcs1?

To effectively analyze time-resolved conformational changes in Bcs1:

  • High-Speed AFM Analysis:

    • Implement HS-AFM with line scanning (HS-AFM-LS) to capture rapid conformational dynamics

    • Set up appropriate scan rates with time resolution below 3.3 ms

    • Analyze height/time traces to detect synchronized conformational changes across the heptameric ring

  • Statistical Analysis:

    • Apply time convolution estimation using probability theory

    • Model the distribution of conformational changes using gamma distribution with appropriate rate parameters:
      f(x)=λnxn1eλxΓ(n)f(x) = \frac{\lambda^n x^{n-1} e^{-\lambda x}}{\Gamma(n)}

    • Calculate the probability of detecting non-synchronized conformational changes based on scanning times and transition rates

  • Numerical Simulations:

    • Perform numerical simulations with defined transition times and scan resolutions to validate experimental observations

  • Energy Landscape Mapping:

    • Plot free energy changes as a function of relevant parameters (such as angle α for TMH opening)

    • Identify energy barriers and stable conformational states

These approaches enable quantitative assessment of the concerted power stroke mechanism and provide insights into the kinetics of Bcs1-mediated protein translocation.

What are the key considerations for interpreting structure-function relationships in Bcs1?

When interpreting structure-function relationships in Bcs1, researchers should consider:

  • Nucleotide State Correlation: Different conformational states (apo, ADP-bound, ATP-bound) correlate with specific functional states in the translocation cycle.

  • Cavity Size Changes: The ~70% reduction in matrix cavity size upon ATP binding suggests a physical mechanism for pushing the substrate protein through the membrane .

  • Transmembrane Domain Dynamics: The basket-shaped TMD structure in the apo/ADP state must undergo significant rearrangement to allow substrate passage, but the exact configuration in the ATP-bound state remains to be fully resolved .

  • Energy Coupling: How the energy from ATP hydrolysis is mechanically coupled to protein translocation requires careful consideration of conformational changes and energy barriers.

  • Evolutionary Context: Comparing Bcs1 structure-function relationships with other AAA-ATPases can provide insights into specialized adaptations for membrane protein translocation versus other functions like protein unfolding.

  • Membrane Environment Effects: The lipid environment may influence protein dynamics and should be considered when interpreting structural data obtained from different experimental systems .

How can computational modeling complement experimental studies of Bcs1?

Computational modeling provides powerful complementary approaches to experimental studies of Bcs1:

  • Molecular Dynamics Simulations:

    • Simulate conformational changes upon nucleotide binding and hydrolysis

    • Model interactions between Bcs1 and membrane lipids

    • Predict energetic barriers for substrate translocation

  • Free Energy Calculations:

    • Calculate membrane deformation energies during TMH opening

    • Estimate energetic costs of conformational changes

    • Model using equations like those presented for membrane compression, bending, and tilt energies

  • Sequence-Structure-Function Analysis:

    • Perform multiple sequence alignments to identify conserved functional residues

    • Map conservation patterns onto structural models

    • Predict effects of mutations on protein function

  • Substrate Translocation Modeling:

    • Simulate the passage of folded Rieske iron-sulfur protein through the Bcs1 channel

    • Identify potential interaction sites between substrate and transporter

    • Calculate energy profiles for the translocation process

  • Reaction Pathway Mapping:

    • Use advanced sampling techniques to map the complete reaction pathway of the ATPase cycle

    • Identify metastable intermediates not captured in static structural studies

These computational approaches can generate testable hypotheses and provide mechanistic insights that may be difficult to obtain through experimental methods alone.

What are the most promising future research directions for studying Bcs1?

Several promising research directions for Bcs1 include:

These directions will help resolve the remaining questions about Bcs1 mechanism and function while potentially revealing new principles about membrane protein translocation.

What methodological innovations would advance research on mitochondrial chaperones like Bcs1?

Advancing research on mitochondrial chaperones like Bcs1 would benefit from these methodological innovations:

  • Improved time-resolved structural techniques with sub-millisecond resolution to capture transient conformational states

  • Advanced membrane mimetics that better recapitulate the native mitochondrial membrane environment for functional studies

  • Multimodal approaches combining structural, functional, and dynamical measurements on the same sample

  • In-cell structural biology techniques to study Bcs1 conformations in the native mitochondrial environment

  • Machine learning approaches for analyzing complex datasets from high-throughput mutagenesis and functional assays

  • Microfluidic platforms for rapid screening of conditions affecting Bcs1 function

  • Genetic tools for real-time monitoring of Bcs1 activity and substrate translocation in living cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.