Recombinant Schizosaccharomyces pombe Probable squalene monooxygenase (SPBC713.12)

Shipped with Ice Packs
In Stock

Description

Introduction

Squalene monooxygenase (SQE), also known as squalene epoxidase, is a vital eukaryotic enzyme that utilizes NADPH and diatomic oxygen to convert squalene into 2,3-oxidosqualene (squalene epoxide) . This enzyme is a flavoprotein monooxygenase and is crucial in sterol biosynthesis, often considered a rate-limiting step in this metabolic pathway . In humans, the SQLE gene encodes squalene epoxidase .

Notably, some eukaryotic genomes lack a gene encoding a canonical squalene monooxygenase. Instead, they encode an alternative squalene epoxidase that carries out the same function .

Mechanism of Action

The typical SQE functions as a flavoprotein monooxygenase, forming flavin hydroperoxides at the enzyme's active site. These hydroperoxides then transfer a terminal oxygen atom to the substrate. Unlike other flavin monooxygenases, SQE inserts oxygen into the substrate as an epoxide rather than a hydroxyl group . This enzyme contains a loosely bound FAD flavin and obtains electrons from NADPH-cytochrome P450 reductase, rather than binding NADPH directly . The alternative squalene epoxidase, on the other hand, belongs to the fatty acid hydroxylase superfamily and obtains electrons from cytochrome b5 .

Schizosaccharomyces pombe and Squalene Monooxygenase

Schizosaccharomyces pombe is a species of yeast that has been extensively studied in genetics and molecular biology. Research has explored the flavin-containing monooxygenase gene derived from Schizosaccharomyces pombe (spfmo) .

Flavin-containing Monooxygenase Gene (spfmo) from Schizosaccharomyces pombe

The flavin-containing monooxygenase gene derived from Schizosaccharomyces pombe (spfmo) has been expressed in Escherichia coli BL21(DE3), and the enzymatic properties of the expressed protein have been analyzed . The optimal catalytic conditions for the recombinant SpFMO were found to be 30 ℃ and pH 8.0, achieving an enzyme activity of 72.77 U/g. The presence of Mg2+ enhanced the enzyme's activity .

Kinetic Analysis of SpFMO

ParameterValue
Km (SMC)23.89 μmol/L
kcat/Km (SMC)61.71 L/(min·mmol)
SMCO yield12.31% within 9 hours

Role in Squalene Production

Expression of hopA and hopB (encoding squalene/phytoene synthases) along with hopD (encoding farnesyl diphosphate synthase) yielded 4.1 mg/liter of squalene. This level increased to 11.8 mg/liter with increased expression of dxs and idi, E. coli genes encoding 1-deoxy-d-xylulose 5-phosphate synthase and isopentenyl diphosphate isomerase .

Regulation of Squalene Monooxygenase

Squalene monooxygenase (SM) is a rate-limiting enzyme in the cholesterol biosynthetic pathway, subject to posttranslational regulation via a negative feedback mechanism mediated by cholesterol . Squalene itself stabilizes SM through direct binding to its noncatalytic, N-terminal regulatory domain . Squalene acts as a feedforward regulator of the cholesterol biosynthetic pathway .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
erg1; SPBC713.12; Probable squalene monooxygenase; Squalene epoxidase; SE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
erg1
Target Protein Sequence
MATQDADIIIIGAGITGCALGAALGRQGRKVLVLERDMSEPDRIVGELLQPGGIEALEKI GIADAVEGIDGQWTSGYQIFYGDSNVSVPYPSKPNGGAYQGIGFHYGRFVMNLRKALTST PNVTVTEATVNELLRDETGEVITGVVTSSKKSESPVEYKAPLTIVCDGCFSKFRKAFIDH PIQVTDHFLGLILTNPDYIAPGRGHVILSKVAPMVLYPISSTEARILINYPGKNLPPMET LKKYVLESCVPNMPEKLRPSLKAAVYNDRLRSMPNQFLPPTVNRTKGMILVGDSNNMRHP LTGGGMTVCFHDAYLLSRFISPSAVPDLLDYERILNQMNKFHWKRKGYSFVINVLSIALY KLFTPKNRYMKALESGCIDYFKRGGNCVEGPIRLLGGLDHSPSHLIGHFYAVCLYGIYQY VLSGPALLMPVRIIESLLIFLQASLVIIPYILSEMSS
Uniprot No.

Target Background

Function
This enzyme catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, a rate-limiting step in steroid biosynthesis.
Database Links
Protein Families
Squalene monooxygenase family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Probable squalene monooxygenase (SPBC713.12)?

Schizosaccharomyces pombe Probable squalene monooxygenase, also known as Erg1, is an enzyme encoded by the erg1 gene (SPBC713.12). This enzyme catalyzes the first oxygenation step in the ergosterol biosynthesis pathway, specifically the epoxidation of squalene to 2,3-oxidosqualene. The enzyme belongs to the squalene monooxygenase family and is classified as "probable" based on sequence homology with confirmed squalene monooxygenases in other organisms . In S. pombe, this enzyme plays an essential role in sterol metabolism, which is critical for membrane integrity and cellular function.

How does S. pombe squalene monooxygenase differ from homologous enzymes in other organisms?

S. pombe squalene monooxygenase shows structural and functional differences compared to homologs in plants and mammals. Research indicates that fungal squalene-related enzymes have unique structural features that affect their function and interactions within the sterol pathway. Specifically, there are significant differences in the C-terminal regions of related enzymes (such as squalene synthase) between fungi and other organisms . These structural differences may influence substrate channeling and protein-protein interactions. For example, studies have shown that squalene synthesized by plant enzymes cannot be efficiently used by fungal enzymes in the subsequent steps of the pathway, suggesting species-specific regulatory mechanisms .

What are the known genetic and biochemical characteristics of S. pombe erg1?

The erg1 gene in S. pombe encodes the probable squalene monooxygenase with the systematic name SPBC713.12. The enzyme requires FAD as a cofactor and uses NADPH as an electron donor for the oxidation reaction. The protein is predicted to be membrane-associated, consistent with its role in sterol biosynthesis, which occurs in the endoplasmic reticulum. Recombinant versions of this enzyme can be expressed with tags such as C-Myc/DDK for detection and purification purposes . Antibodies specifically targeting this protein are available for research applications, including ELISA and Western blot analysis .

What expression systems are most effective for recombinant S. pombe squalene monooxygenase production?

Multiple expression systems have been validated for producing recombinant S. pombe squalene monooxygenase, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid growthMay lack proper folding and post-translational modifications
YeastNatural environment for fungal proteins, appropriate post-translational modificationsModerate yield, longer growth time
BaculovirusSupports complex eukaryotic protein foldingTechnical complexity, moderate cost
Mammalian cellsMost native-like processing and modificationsHighest cost, lowest yield
Cell-free expressionAvoids toxicity issues, rapidLimited scale, higher cost

For membrane-associated proteins like squalene monooxygenase, yeast expression systems often provide a good balance between proper folding and reasonable yield. Researchers have achieved greater than 85% purity using various expression hosts, as determined by SDS-PAGE analysis .

How can activity of recombinant S. pombe squalene monooxygenase be reliably measured?

Measuring the activity of recombinant S. pombe squalene monooxygenase requires specialized methods that address its membrane association and specific catalytic properties:

  • Enzymatic assays using purified microsomes or reconstituted systems with:

    • HPLC or LC-MS detection of 2,3-oxidosqualene formation

    • Radiometric assays with 14C-labeled squalene

    • Oxygen consumption measurements

  • Complementation assays in erg1-deficient yeast strains:

    • Monitor restoration of ergosterol biosynthesis

    • Measure growth rescue under ergosterol-limiting conditions

  • In vitro reconstitution systems:

    • Incorporate purified enzyme into liposomes or nanodiscs

    • Add required cofactors (FAD, NADPH)

    • Measure substrate conversion under controlled conditions

Evidence from related squalene metabolism studies suggests that enzyme activity is highly dependent on the proper membrane environment and presence of interacting proteins . Researchers should note that exogenous squalene has been shown to be a poor substrate compared to endogenously produced squalene in yeast systems, suggesting the importance of substrate channeling in this pathway .

What purification strategies yield the highest activity for S. pombe squalene monooxygenase?

Purification of active S. pombe squalene monooxygenase requires strategies that maintain the enzyme's native conformation and association with membrane components:

  • Membrane fraction isolation:

    • Differential centrifugation to isolate microsomes

    • Detergent solubilization using mild non-ionic detergents (DDM, CHAPS)

  • Affinity chromatography:

    • Using tagged versions (C-Myc/DDK tags are effective)

    • Immobilized substrate or inhibitor columns

  • Size exclusion chromatography:

    • To separate monomeric enzyme from aggregates

    • Can be performed in the presence of detergent micelles

  • Storage considerations:

    • Store at -80°C to maintain stability

    • Avoid repeated freeze-thaw cycles

    • Consider adding stabilizing agents (glycerol, reducing agents)

Typical workflow yields ≥85% purity as determined by SDS-PAGE . Western blot analysis using specific antibodies can confirm the identity of the purified protein. For S. pombe proteins, maintaining native-like conditions during purification is critical, as demonstrated in studies with other recombinant S. pombe enzymes .

How does S. pombe squalene monooxygenase interact with other enzymes in the ergosterol biosynthesis pathway?

Evidence suggests significant protein-protein interactions within the ergosterol biosynthesis pathway in yeasts:

  • Substrate channeling: Studies with related enzymes show that squalene produced endogenously is more efficiently utilized than exogenous squalene, suggesting physical association between pathway enzymes .

  • Complex formation: Research indicates that squalene synthase (SQS) and squalene epoxidase (SQLE) may form a complex in yeast microsomes . This interaction might be facilitated by specific C-terminal sequences present in yeast enzymes but absent in mammalian or plant homologs.

  • Membrane organization: The ergosterol biosynthesis enzymes likely co-localize in specific ER membrane domains.

Methodologies to investigate these interactions include:

  • Co-immunoprecipitation studies

  • Proximity labeling approaches

  • Fluorescence resonance energy transfer (FRET)

  • Protein-fragment complementation assays

  • Gene and protein network analysis using approaches described for other S. pombe systems

Research has demonstrated that a sequence of approximately 30 amino acids present in the C-terminal region of yeast SQS (absent in plant and mammalian homologs) may be involved in specific interactions with downstream enzymes like squalene monooxygenase .

What structural features determine substrate specificity in S. pombe squalene monooxygenase?

The substrate specificity of S. pombe squalene monooxygenase is determined by several structural features:

  • Catalytic site architecture:

    • FAD-binding domain

    • Substrate-binding pocket geometry

    • Conserved residues involved in oxygen activation

  • Membrane interaction domains:

    • Hydrophobic regions that anchor the enzyme to the ER membrane

    • Positioning of the active site relative to the membrane surface

  • Species-specific substrate recognition:

    • Fungal-specific residues that may contribute to differences in substrate utilization compared to mammalian enzymes

Experimental approaches to investigate these features include:

  • Site-directed mutagenesis of conserved and variable residues

  • Chimeric enzyme construction (similar to approaches used with SQS)

  • Homology modeling based on related crystal structures

  • Activity assays with substrate analogs and inhibitors

Studies with related enzymes have shown that chimeric derivatives containing specific fungal C-terminal regions can alter substrate utilization patterns, suggesting important structural determinants in this region .

How is S. pombe squalene monooxygenase activity regulated in response to cellular conditions?

Regulation of S. pombe squalene monooxygenase likely occurs at multiple levels:

  • Transcriptional regulation:

    • Sterol-responsive element binding proteins (SREBPs)

    • Stress-responsive transcription factors

    • Network-based co-regulation with other metabolic genes

  • Post-translational modifications:

    • Phosphorylation affecting enzyme activity or stability

    • Ubiquitination and proteasomal degradation

  • Metabolite-based regulation:

    • Feedback inhibition by downstream sterol products

    • Oxygen availability sensing

    • Redox state affecting FAD and NADPH cofactors

  • Protein-protein interactions:

    • Association with regulatory proteins

    • Changes in complex formation under different conditions

Investigation methodologies include:

  • Gene expression analysis under various conditions

  • Protein modification mapping by mass spectrometry

  • Metabolic flux analysis of the sterol pathway

  • Co-expression network construction as described for other S. pombe systems

Studies of stress responses in S. pombe provide frameworks for understanding how metabolic enzymes like squalene monooxygenase respond to changing cellular environments .

What are common challenges in expressing active S. pombe squalene monooxygenase and how can they be addressed?

Researchers face several challenges when working with recombinant S. pombe squalene monooxygenase:

  • Protein solubility issues:

    • Challenge: As a membrane-associated enzyme, it may aggregate during expression

    • Solution: Use fusion tags that enhance solubility; express in membrane fractions of host cells; optimize detergent selection for extraction

  • Cofactor incorporation:

    • Challenge: Incomplete incorporation of the FAD cofactor

    • Solution: Supplement expression media with riboflavin; add FAD during purification steps

  • Low enzymatic activity:

    • Challenge: Loss of activity during purification

    • Solution: Minimize purification steps; use gentler detergents; purify in the presence of stabilizing agents

  • Expression host compatibility:

    • Challenge: Poor expression in heterologous systems

    • Solution: Try multiple expression systems; cell-free expression may help overcome toxicity issues

  • Protein verification:

    • Challenge: Confirming authentic expression

    • Solution: Use Western blot with specific antibodies; verify by mass spectrometry

Experience with recombinant S. pombe protein expression suggests that maintaining proper membrane environment and minimizing purification steps are critical for retaining enzymatic activity .

How can researchers distinguish between specific S. pombe squalene monooxygenase activity and background reactions?

Establishing specific enzymatic activity requires careful experimental controls:

  • Negative controls:

    • Heat-inactivated enzyme preparations

    • Enzyme preparations from cells transformed with empty vectors

    • Assays performed in the absence of essential cofactors (FAD, NADPH)

  • Specific inhibition:

    • Use of known squalene monooxygenase inhibitors

    • Dose-response relationships with inhibitors

  • Substrate specificity:

    • Activity measurements with squalene analogs

    • Comparison of kinetic parameters with those of characterized homologs

  • Product verification:

    • MS or NMR confirmation of 2,3-oxidosqualene formation

    • Coupling with downstream enzymatic reactions

  • Antibody-based approaches:

    • Immunodepletion of the enzyme from active preparations

    • Activity restoration by adding back purified enzyme

Similar approaches have been used to characterize other recombinant S. pombe enzymes, demonstrating the importance of rigorous controls in establishing specific enzymatic activity .

What analytical methods provide the most reliable data for S. pombe squalene monooxygenase characterization?

Comprehensive characterization of S. pombe squalene monooxygenase requires multiple analytical approaches:

  • Protein characterization:

    • SDS-PAGE for purity assessment (≥85% purity is achievable)

    • Western blot using specific antibodies (anti-tag or anti-Erg1)

    • Mass spectrometry for precise molecular weight and modification analysis

    • Circular dichroism for secondary structure assessment

  • Activity measurements:

    • HPLC or LC-MS for product quantification

    • UV-visible spectroscopy to monitor FAD redox state

    • Oxygen consumption measurements

    • Radiometric assays with labeled substrates

  • Interaction studies:

    • Surface plasmon resonance for binding kinetics

    • Co-immunoprecipitation for protein complex identification

    • Network analysis approaches as described for other S. pombe systems

  • Structural characterization:

    • Homology modeling based on related structures

    • Limited proteolysis to identify domain boundaries

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

For membrane-associated enzymes like squalene monooxygenase, maintaining the native lipid environment during analysis is critical for obtaining physiologically relevant data. Complementary approaches combining biochemical, biophysical, and genetic methods provide the most comprehensive characterization.

How can systems biology approaches enhance our understanding of S. pombe squalene monooxygenase function?

Systems biology offers powerful frameworks for investigating S. pombe squalene monooxygenase in its broader cellular context:

  • Network-based analysis:

    • Co-expression networks to identify functionally related genes

    • Protein-protein interaction networks to map ergosterol biosynthesis complexes

    • Metabolic flux analysis to quantify pathway dynamics

  • Comparative genomics:

    • Evolutionary analysis of squalene monooxygenases across fungal species

    • Identification of conserved regulatory elements

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Correlation of enzyme activity with global cellular responses

Methodologies include:

  • Network construction techniques as described for S. pombe

  • Time-course analyses of stress responses

  • Integration of multiple data types through computational modeling

These approaches can reveal how squalene monooxygenase functions within larger cellular programs and identify unexpected connections to other biological processes.

What genetic engineering strategies can optimize S. pombe squalene monooxygenase for biotechnological applications?

Genetic engineering approaches can enhance S. pombe squalene monooxygenase for various research and biotechnological applications:

  • Enzyme engineering:

    • Directed evolution for improved stability or activity

    • Rational design based on structural insights

    • Domain swapping with homologs (similar to approaches with SQS)

  • Expression optimization:

    • Codon optimization for various expression hosts

    • Fusion with solubility-enhancing tags

    • Integration of expression cassettes at specific genomic loci in S. pombe

  • Pathway engineering:

    • Co-expression with interacting proteins

    • Balancing expression levels of pathway enzymes

    • Creating synthetic enzyme complexes

Successful genetic engineering has been demonstrated with other S. pombe enzymes, such as the expression of bacterial PHA biosynthesis genes in S. pombe, which resulted in significant product accumulation . Similar strategies could be applied to optimize squalene monooxygenase function for specific applications.

How might structural biology advances improve our understanding of S. pombe squalene monooxygenase?

Structural biology approaches offer transformative insights into S. pombe squalene monooxygenase:

  • High-resolution structures:

    • X-ray crystallography of soluble domains

    • Cryo-electron microscopy for full-length protein

    • NMR studies of specific domains or interactions

  • Dynamics and conformational changes:

    • Hydrogen-deuterium exchange mass spectrometry

    • Molecular dynamics simulations

    • Single-molecule FRET studies

  • Complex formation:

    • Structures of squalene monooxygenase with interacting partners

    • Visualization of substrate channeling mechanisms

    • Mapping of membrane interactions

These approaches could resolve key questions about:

  • How substrate specificity is determined

  • How membrane association influences enzyme function

  • The structural basis for interactions with other pathway enzymes

Structural investigations of fungal squalene-related enzymes have already provided valuable insights into their function and regulation , and similar approaches would be valuable for S. pombe squalene monooxygenase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.