Recombinant Schizosaccharomyces pombe Protein bem46 (bem46)

Shipped with Ice Packs
In Stock

Description

Introduction

The Bud Emergence 46 (Bem46) protein, initially identified in Neurospora crassa, is a member of the $$\alpha/\beta$$-hydrolase superfamily . It is considered a conserved "known unknown" eukaryotic gene, which are genes that are widespread and conserved in eukaryotes, but whose functions are not yet fully understood . Phylogenetic analysis indicates that Bem46 is present in all eukaryotes, with vertebrates possessing multiple paralogs .

Characteristics of Bem46 Protein

Bem46 protein, as identified in N. crassa, is localized in the perinuclear endoplasmic reticulum (ER) and forms spots near the plasma membrane . It plays a role in cell type-specific polarity formation in N. crassa . The protein's amino acid sequence is highly conserved among eukaryotes .

Molecular Evolution

Comparative genomic analyses have revealed insertion/deletion (indel) variations within the conserved domain of Bem46, which can differentiate fungal classes such as ascomycetes from basidiomycetes . Exonic indels can also distinguish Bem46 homologs across different eukaryotic lineages .

Functional Analysis

Functional analysis of Bem46 in N. crassa has identified a novel endoplasmic-retention signal (PEKK) through GFP-fusion tagging experiments . Three critical residues—serine 188S, histidine 292H, and aspartic acid 262D—are believed to form a catalytic triad in the Bem46 protein of N. crassa .

Significance of Recombinant Proteins

Recombinant proteins, including Bem46, are valuable in various biological applications . They are used in functional assays to study protein interactions, receptor-ligand binding, and enzyme activities . The recombinant proteins market is experiencing growth, driven by advancements in gene editing technologies and the optimization of protein expression .

Gene Editing Technologies

Gene editing technologies like CRISPR-Cas9, TALENs, and ZFNs are crucial for enhancing the expression, stability, and functionality of recombinant proteins . CRISPR-Cas9, in particular, is widely used to modify the genomes of host cells for protein expression, leading to optimizations in industrial potential .

Challenges in Delivery Systems

An efficient delivery system for recombinant proteins is a challenge in biotechnology and medicine due to biological barriers such as cellular membranes, mucosal barriers, and the blood-brain barrier . Overcoming these barriers, maintaining protein stability, achieving target specificity, reducing immunogenicity, and controlling dosage are key considerations in developing effective protein delivery systems .

Table: Comparison of Genes in Different Bacillus Species

FeatureB. velezensis Q-426B. velezensis FZB42B. velezensis SQR9B. amyloliquefaciens DSM7B. subtilis 168
CDS number4691Not specifiedNot specifiedNot specifiedNot specified
Secondary metabolite clusters141312116

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
bem46; pi020; SPBC32H8.03; Protein bem46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
bem46
Target Protein Sequence
MAGSLSSAIFNVLKYSGMASLAVTLIALGFLYKYQKTLVYPSAFPQGSRENVPTPKEFNM EYERIELRTRDKVTLDSYLMLQSESPESRPTLLYFHANAGNMGHRLPIARVFYSALNMNV FIISYRGYGKSTGSPSEAGLKIDSQTALEYLMEHPICSKTKIVVYGQSIGGAVAIALTAK NQDRISALILENTFTSIKDMIPTVFPYGGSIISRFCTEIWSSQDEIRKIKKLPVLFLSGE KDEIVPPPQMVLLFGLCGSAKKKFHSFPKCTHNDTCLGDGYFQVIADFLAENDINTPAS
Uniprot No.

Target Background

Function
Suppressor of Bem1/Bud5.
Database Links
Protein Families
Serine esterase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the bem46 protein and what superfamily does it belong to?

The bem46 protein is an evolutionarily conserved member of the α/β-hydrolase superfamily, which encompasses enzymes with diverse functions and a wide range of substrates . The bem46 gene of Schizosaccharomyces pombe (EMBL accession number U29892) was initially identified as a suppressor of the bem1 bud5 double mutant of Saccharomyces cerevisiae, which shows defects in cell polarization and budding processes . The protein contains a catalytic triad typical of α/β-hydrolases, although its specific enzymatic activity remains under investigation. Structural analysis suggests it maintains the conserved fold characteristic of this enzyme family, with a central β-sheet surrounded by α-helices.

What is currently known about bem46's cellular localization in yeast?

Based on studies in related fungi like Neurospora crassa, the BEM46 protein localizes to multiple cellular compartments, primarily the perinuclear endoplasmic reticulum (ER) and patches near the plasma membrane . More specifically, BEM46 shows eisosomal localization, which has been demonstrated through colocalization studies with known eisosomal proteins such as the PILA ortholog from Aspergillus nidulans . This eisosomal localization is particularly interesting as eisosomes are static plasma membrane-associated protein complexes that mark sites of endocytosis in fungi, suggesting bem46 may participate in membrane-associated processes or protein trafficking.

What expression systems are most effective for producing recombinant S. pombe bem46 protein?

The expression construct design should include:

  • A strong, preferably inducible promoter

  • Appropriate fusion tags (His6, GST, or MBP) for purification

  • Optional protease cleavage sites for tag removal

  • Codon optimization if expressing in non-yeast systems

What purification strategies yield the highest purity and activity for recombinant bem46?

A multi-step purification strategy is recommended for obtaining high-purity recombinant bem46:

  • Initial Capture: Affinity chromatography based on the fusion tag (e.g., IMAC for His-tagged protein, glutathione-sepharose for GST-fusion)

  • Intermediate Purification: Ion exchange chromatography (IEX) based on the protein's theoretical pI

  • Polishing: Size exclusion chromatography (SEC) to remove aggregates and achieve high purity

Key buffer considerations include:

  • Maintaining physiological pH (typically 6.5-7.5 for yeast proteins)

  • Including reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Adding glycerol (5-10%) to enhance protein stability

  • Considering detergent addition (0.01-0.05% non-ionic detergents) if membrane association is observed

Successful purification should be verified by SDS-PAGE, Western blotting, and activity assays if available.

How can researchers assess the functional activity of purified recombinant bem46?

  • Thermal shift assays: To evaluate proper folding and stability

  • Binding assays: To measure interaction with known partners like components of the cell polarity machinery

  • Complementation assays: Testing if the recombinant protein can rescue phenotypes in bem46 knockout strains

  • In vitro hydrolase activity screens: Using generic substrates for α/β-hydrolases such as p-nitrophenyl esters

For S. pombe bem46 specifically, functional verification might include testing its ability to suppress the bem1 bud5 double mutant phenotype in S. cerevisiae, as this was the original context of its identification .

What phenotypes are observed in bem46 knockout strains of different fungi?

Studies with bem46 knockout strains across different fungal species reveal both shared and species-specific phenotypes:

  • Neurospora crassa: A Δbem46 mutant shows approximately 50% reduced ascospore germination compared to wild-type strains, though this reduction is less severe than in bem46 RNAi-silenced or overexpression strains . Vegetative mycelia development appears normal in terms of hyphal and conidiophore formation .

  • Saccharomyces cerevisiae: The bem46 homolog (YNL320W) is not essential for viability , suggesting redundancy in its functional pathways or a non-critical role under standard growth conditions.

  • Plasmodium species: Studies with Plasmodium BEM46-like protein (PBLP) knockout parasites (Δpblp) showed multiple defects including:

    • Fewer merozoites formed during schizogony

    • Decreased parasitemia compared to wild-type

    • Reduced oocyst numbers and sporozoite development

    • Decreased sporozoite infectivity in hepatocytes

    • Delayed onset of blood-stage patency

These diverse phenotypes across species suggest that bem46 proteins have evolved specialized functions while maintaining core roles in morphogenesis and development processes. The variation in severity of knockout effects indicates different degrees of functional redundancy or importance across species.

How does alternative splicing affect bem46 function?

Research in Neurospora crassa has revealed important insights into bem46 alternative splicing:

  • Identification of splice variants: Two types of alternatively spliced bem46 mRNA have been identified in Neurospora crassa .

  • Functional consequences: Expression of either alternatively spliced mRNA type leads to a complete loss of ascospore germination in Neurospora . This suggests that alternative splicing plays a critical regulatory role in bem46 function.

  • Mechanistic insight: The phenotype caused by these alternatively spliced variants was not due to bem46 mRNA downregulation or loss, but rather was caused by the alternatively spliced mRNAs themselves and the peptides they encoded . This indicates that alternative splicing may generate protein variants with altered, possibly dominant-negative, functions.

For researchers working with S. pombe bem46, these findings highlight the importance of examining potential splice variants that may exist in this organism as well, as they could significantly impact function and experimental outcomes.

What is known about the structure-function relationship in bem46 proteins?

The structure-function relationship of bem46 proteins can be analyzed from several perspectives:

  • Catalytic domain: As members of the α/β-hydrolase superfamily, bem46 proteins contain a predicted catalytic triad essential for potential enzymatic activity . Mutation studies targeting these residues would be valuable for determining if hydrolase activity is required for biological function.

  • Membrane association: The BEM46 protein in N. crassa is closely associated with the parasite plasma membrane and contains an unusual ER retention signal at the C-terminal end . This suggests that membrane localization is critical for function, possibly facilitating interactions with membrane-associated signaling complexes.

  • Protein-protein interaction domains: The identification of anthranilate synthase component II (encoded by trp-1) as an interaction partner of bem46 in N. crassa suggests the presence of specific interaction domains. Mapping these interaction surfaces would provide insight into bem46's role in signaling networks.

  • Eisosomal localization determinants: The colocalization of bem46 with eisosomes indicates structural elements that target the protein to these specialized membrane domains. Identifying these sequences would help understand bem46's role in membrane organization and endocytosis.

Systematic mutational analysis focusing on these structural elements would significantly advance understanding of bem46 function.

What proteins interact with bem46 and what signaling pathways is it involved in?

Studies primarily in Neurospora crassa have identified several protein interactions and pathway connections for bem46:

  • Direct protein interactions:

    • Anthranilate synthase component II (encoded by trp-1): Identified through yeast two-hybrid screening and confirmed in vivo using split-YFP approaches .

    • MTR neutral amino acid transporter: Shown to colocalize with bem46 in eisosomes, suggesting functional association .

  • Signaling pathways:

    • Auxin biosynthesis: bem46 influences the auxin biosynthetic pathway, with bem46 transformant and mutant strains showing altered expression of genes involved in this pathway .

    • Cell polarity establishment: Given bem46's role as a suppressor of bem1 bud5 double mutant phenotypes in S. cerevisiae, it likely intersects with Rho GTPase signaling networks controlling polarized growth .

    • Indole production: bem46 transformant strains show altered indole production during different developmental stages, particularly during germination of asco- and conidiospores .

While these interactions have been primarily characterized in N. crassa, the evolutionary conservation of bem46 suggests that similar interaction networks may exist in S. pombe, providing a foundation for targeted interaction studies.

How does bem46 contribute to auxin biosynthesis regulation in fungi?

Research has revealed an intriguing connection between bem46 and auxin biosynthesis in fungi:

  • Pathway identification: Bioinformatic tools were used to identify a putative auxin biosynthetic pathway in Neurospora crassa . The genes involved in this pathway exhibited various levels of transcriptional regulation in different bem46 transformant and mutant strains.

  • Indole production analysis: The relative indole production of Δtrp-1 and Δbem46 mutants, as well as bem46 transformant strains, was determined in different developmental stages of N. crassa . During germination of asco- and conidiospores, auxin production significantly varied across these strains.

  • Gene expression changes: The expression of genes coding for enzymes in the putative auxin biosynthetic pathway was significantly altered in bem46 mutant and transformant strains , suggesting regulatory control.

  • Functional hypothesis: Based on protein interaction data and localization studies, it has been hypothesized that BEM46 acts at the intersection of indole uptake and biosynthesis in N. crassa . BEM46's colocalization with the neutral amino acid transporter MTR in eisosomes further supports a potential role in controlling substrate availability for auxin biosynthesis.

This connection between bem46 and auxin biosynthesis represents an exciting area for future research, particularly given auxin's known roles in regulating growth and development in fungi.

What is known about the role of bem46 in eisosomes and membrane organization?

Eisosomes are specialized plasma membrane domains in fungi that are associated with endocytosis and membrane organization. Research on bem46 has revealed:

  • Localization pattern: BEM46 in Neurospora crassa shows eisosomal localization, demonstrated through colocalization studies with established eisosomal markers like the PILA ortholog from Aspergillus nidulans .

  • Functional associations: Within eisosomes, BEM46 colocalizes with the neutral amino acid transporter MTR , suggesting a potential role in regulating amino acid transport or utilization at specific membrane domains.

  • Developmental context: The localization pattern of BEM46 changes during development. While it is associated with the plasma membrane in some developmental stages, it localizes to unique intracellular structures in others (as observed with the Plasmodium BEM46-like protein in sporozoites) .

  • Potential mechanisms: Given BEM46's membership in the α/β-hydrolase superfamily, it might modify lipids or proteins within eisosomes, potentially affecting membrane curvature, fluidity, or protein organization. Alternatively, it could serve as a scaffold for assembling protein complexes within these specialized domains.

The eisosomal localization of bem46 provides important clues about its function, potentially linking it to endocytosis, membrane compartmentalization, or signal transduction at specific plasma membrane domains.

How conserved is bem46 across different species and what does this suggest about its function?

The evolutionary conservation of bem46 provides valuable insights into its functional importance:

This evolutionary pattern of core conservation with lineage-specific adaptations suggests that bem46 participates in fundamental cellular processes while acquiring specialized roles in different biological contexts.

What are the key differences between bem46 in S. pombe and its homologs in other model organisms?

Comparative analysis reveals important similarities and differences between bem46 proteins across species:

  • S. pombe vs. S. cerevisiae:

    • Functional context: S. pombe bem46 acts as a suppressor of bem1 bud5 double mutant phenotypes in S. cerevisiae

    • Essentiality: The S. cerevisiae bem46 homolog (YNL320W) is not essential , suggesting potential functional redundancy

    • Cell morphology context: S. pombe's rod-shaped cells with bipolar growth pattern may utilize bem46 differently compared to S. cerevisiae's budding growth pattern

  • S. pombe vs. Neurospora crassa:

    • Subcellular localization: N. crassa BEM46 localizes to the perinuclear ER and eisosomes , and similar localization might be expected in S. pombe

    • Developmental role: N. crassa BEM46 is critical for ascospore germination , while specific developmental roles in S. pombe remain to be fully characterized

    • Alternative splicing: N. crassa bem46 undergoes alternative splicing with functional consequences ; whether similar mechanisms exist in S. pombe is unknown

  • S. pombe vs. Plasmodium BEM46-like protein (PBLP):

    • Developmental context: PBLP functions in erythrocytic stage merozoite development and invasive-stage morphogenesis , reflecting adaptation to parasite-specific life cycles

    • Membrane association: PBLP associates with the parasite plasma membrane in some stages but localizes to unique intracellular structures in others , suggesting context-dependent localization that may also occur in S. pombe

Understanding these differences provides a framework for hypothesis development regarding S. pombe bem46 function and guides experimental approaches for its characterization.

How is bem46 research in S. pombe relevant to understanding human diseases?

While bem46 is primarily studied in model organisms, its research has potential relevance to human health:

  • Parasite biology: The characterization of BEM46-like proteins in Plasmodium has revealed its importance in parasite development and infectivity . Understanding bem46 function could potentially identify new targets for anti-malarial therapies by revealing fundamental mechanisms of parasite morphogenesis.

  • Conserved cellular processes: BEM46 participates in fundamental cellular processes like polarized growth and membrane organization that are conserved from yeast to humans. Insights from S. pombe bem46 could illuminate similar processes in human cells that are relevant to:

    • Neuronal development (polarized growth)

    • Immune cell function (membrane reorganization during activation)

    • Cancer biology (altered cell polarity in malignant transformation)

  • Drug discovery platform: S. pombe bem46 research could establish experimental systems for screening compounds that modulate α/β-hydrolase function, potentially identifying lead compounds for therapeutic development targeting human homologs.

  • Biotechnology applications: Understanding bem46's role in cellular morphogenesis could contribute to bioengineering efforts aimed at controlling cell shape and organization, with potential applications in synthetic biology and regenerative medicine.

While direct clinical applications may be distant, fundamental research on bem46 in model organisms like S. pombe contributes to our understanding of conserved biological processes relevant to human health and disease.

What are the most effective approaches for studying bem46 localization and dynamics in living cells?

Advanced imaging techniques provide powerful tools for investigating bem46 localization and dynamics:

  • Fluorescent protein fusion strategies:

    • C-terminal tagging appears viable as demonstrated in N. crassa studies

    • Consider multiple fluorescent proteins (GFP, mCherry, mScarlet) to accommodate different experimental requirements

    • Validate that tagging does not disrupt localization or function through complementation assays

  • High-resolution microscopy techniques:

    • Confocal microscopy for colocalization with other cellular structures

    • Super-resolution techniques (STORM, PALM, or SIM) to resolve eisosomal structures that are below the diffraction limit

    • Lattice light-sheet microscopy for long-term imaging with minimal phototoxicity

  • Dynamic analysis methods:

    • Fluorescence recovery after photobleaching (FRAP) to measure bem46 mobility within membranes

    • Single-particle tracking to analyze movement of individual bem46 molecules

    • Photoactivatable or photoconvertible tags to track specific bem46 subpopulations over time

  • Correlative approaches:

    • Correlative light and electron microscopy (CLEM) to connect fluorescence localization with ultrastructural context

    • Proximity labeling techniques (BioID, APEX) to identify proteins in the immediate vicinity of bem46

These approaches, particularly when used in combination, can provide comprehensive insights into bem46's dynamic behavior, interactions, and functional contexts within living cells.

What genetic and biochemical approaches are most useful for investigating bem46 protein interactions?

Multiple complementary approaches can be employed to identify and characterize bem46 interactions:

  • Genetic interaction screens:

    • Synthetic genetic array (SGA) analysis to identify genes that show synthetic lethality or fitness defects when mutated in combination with bem46 deletion

    • Suppressor screens to identify mutations that rescue bem46 mutant phenotypes

    • Multi-copy suppressor screens to identify genes that, when overexpressed, compensate for bem46 deletion

  • Protein-protein interaction methods:

    • Affinity purification coupled with mass spectrometry (AP-MS) using tagged bem46 as bait

    • Yeast two-hybrid screening, which has successfully identified bem46 interactors in N. crassa

    • Proximity-dependent biotin labeling (BioID, TurboID) to capture transient or context-dependent interactions

    • Split fluorescent protein complementation (as used with N. crassa bem46 and trp-1)

  • Biochemical characterization:

    • Co-immunoprecipitation to validate direct interactions

    • Surface plasmon resonance or isothermal titration calorimetry to determine binding affinities

    • Cross-linking mass spectrometry to map interaction interfaces

  • Structural approaches:

    • X-ray crystallography or cryo-EM of bem46 in complex with interaction partners

    • NMR spectroscopy for analyzing dynamic interactions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

The combination of these approaches would provide a comprehensive understanding of bem46's interaction network and guide functional studies.

How can researchers effectively model and predict bem46 function across species?

Computational approaches offer powerful tools for predicting bem46 function and guiding experimental design:

  • Homology modeling and structural analysis:

    • Generate 3D models of bem46 proteins from different species using AlphaFold or similar tools

    • Compare predicted active sites and binding pockets to infer functional conservation or divergence

    • Molecular dynamics simulations to analyze protein flexibility and potential conformational changes

  • Network-based approaches:

    • Construct protein-protein interaction networks around bem46 in different species

    • Apply machine learning algorithms to predict functional associations based on network topology

    • Compare network motifs across species to identify conserved functional modules

  • Expression correlation analysis:

    • Analyze co-expression patterns of bem46 with other genes across conditions

    • Identify gene sets that show consistent co-regulation with bem46 across species

    • Apply gene set enrichment analysis to infer potential functional pathways

  • Evolutionary sequence analysis:

    • Identify conserved sequence motifs and functional domains through multiple sequence alignment

    • Calculate site-specific evolutionary rates to identify functionally constrained regions

    • Perform ancestral sequence reconstruction to trace the evolutionary history of bem46

  • Systems biology integration:

    • Combine multiple data types (genomic, transcriptomic, proteomic, metabolomic) to develop predictive models

    • Apply constraint-based modeling to predict the effects of bem46 perturbation on cellular physiology

    • Develop mathematical models of bem46-associated processes based on experimental data

These computational approaches, when integrated with experimental validation, can significantly accelerate functional discovery and provide testable hypotheses about bem46 function across evolutionary space.

What are the most significant unanswered questions about bem46 function?

Despite progress in bem46 research, several fundamental questions remain:

  • Enzymatic activity: Does bem46 function as an active hydrolase, and if so, what are its natural substrates? The catalytic triad typical of α/β-hydrolases suggests enzymatic potential, but direct biochemical evidence of activity is lacking.

  • Regulatory mechanisms: How is bem46 expression, localization, and activity regulated in response to cellular needs? Understanding the upstream signals and pathways that control bem46 would clarify its position in cellular signaling networks.

  • Eisosomal function: What is the specific role of bem46 in eisosomes? While localization has been established , the functional significance of this association and how bem46 contributes to eisosome formation or activity remains unclear.

  • Developmental switching: How does bem46 function change during different developmental stages? The altered localization observed in different life cycle stages of Plasmodium suggests context-dependent functions that warrant investigation in other organisms.

  • Integration with metabolic pathways: What is the mechanistic basis for bem46's influence on indole and auxin production ? The connection between a potential membrane-associated hydrolase and metabolic pathways remains to be fully elucidated.

Addressing these questions would significantly advance understanding of bem46 biology and potentially reveal new functional paradigms for this conserved protein family.

What emerging technologies might accelerate bem46 research?

Several cutting-edge technologies offer particular promise for bem46 research:

  • CRISPR-based approaches:

    • Prime editing for precise genomic modifications to study structure-function relationships

    • CRISPRi/CRISPRa for conditional regulation of bem46 expression

    • CRISPR screens to identify genetic interactions in a high-throughput manner

  • Advanced protein engineering:

    • Optogenetic tools to control bem46 activity or localization with light

    • Genetically encoded biosensors to monitor bem46-associated enzymatic activities in real time

    • Engineered protein scaffolds to manipulate bem46 interaction networks

  • Spatial omics technologies:

    • Spatial transcriptomics to map gene expression patterns in relation to bem46 localization

    • Imaging mass spectrometry to analyze metabolite distributions in bem46 mutants

    • Proximity proteomics with subcellular resolution to map bem46 interaction networks in specific compartments

  • Single-cell approaches:

    • Single-cell RNA-seq to characterize cell-to-cell variability in bem46-associated pathways

    • Single-cell proteomics to analyze protein network changes in response to bem46 perturbation

    • Microfluidics-based single-cell phenotyping to characterize bem46 mutant heterogeneity

  • In vitro reconstitution systems:

    • Synthetic membrane systems to study bem46's interaction with lipids and membrane proteins

    • Cell-free expression systems to rapidly produce and test bem46 variants

    • Biomimetic eisosome models to study bem46's role in membrane organization

These technologies, particularly when used in combination, could overcome current technical barriers and provide new insights into bem46 function.

How might research on bem46 contribute to broader understanding of cellular systems?

Bem46 research has potential to advance understanding of several fundamental biological processes:

  • Membrane organization principles: The eisosomal localization of bem46 provides an entry point for studying how specialized membrane domains form and function in eukaryotic cells. Insights could extend to understanding similar structures in mammalian cells, such as caveolae or lipid rafts.

  • Polarized growth mechanisms: Given bem46's role in cell polarization , research could illuminate conserved mechanisms governing asymmetric cell division, directed growth, and morphogenesis across eukaryotes.

  • Metabolic-cytoskeletal integration: The connection between bem46 and auxin biosynthesis , coupled with its role in morphogenesis, suggests it may function at the interface between metabolism and cytoskeletal organization – an emerging area of interest in cell biology.

  • Evolutionary adaptation of signaling networks: Comparative studies of bem46 across species could reveal how conserved proteins are repurposed for species-specific functions, providing insights into the evolution of signaling networks.

  • Principles of protein moonlighting: If bem46 proves to have multiple distinct functions (enzymatic activity, structural roles, signaling functions), it could serve as a model for understanding how proteins evolve multiple functions without sequence duplication.

By addressing these broader questions, bem46 research contributes not only to understanding this specific protein but also to advancing fundamental concepts in cellular and evolutionary biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.