Recombinant Schizosaccharomyces pombe Protein get1 (get1)

Shipped with Ice Packs
In Stock

Description

Function and Mechanism

The Get1/2 complex facilitates the insertion of TA proteins into the ER membrane . The Get1/2 complex directly interacts with the TMD of TA substrates during their insertion into the ER membrane . Get1 and Get2 cooperate to capture and remodel the targeting complex .

The Get1/2 complex works with Get3, with Get2 inducing Get3 opening, which is important for efficient TA insertion in vivo . Specifically, the H1 and H2 motifs on the Get2 C-terminal domain (Get2CD) mediate Get3 opening and facilitate GET-dependent TA insertion in vivo .

Subcellular Localization

In S. pombe cells, exogenously expressed Get1 localizes to the cytosol .

Genetic Studies and Mutant Analysis

  • Get1/2 Transmembrane Domain Mutations Mutations in the Get1/2 transmembrane domain can disrupt TA protein insertion, leading to elevated heat shock factor activity, which monitors TA protein aggregation in the cytosol due to compromised Get1/2 function .

  • Complementation Studies Studies have utilized mutant strains of S. pombe to investigate Ran-binding protein 1 (Sbp1), which is involved in GTPase activity. Introducing mutations in the sbp1 gene disrupts cell function, but this can be rescued by exogenous expression of the Ran-binding domain (RBD) of Sbp1 or mammalian RanBP1 .

Techniques Used in Research

  • GFP Cell Reporter Assay A GFP cell reporter of heat shock factor transcriptional activity is used to monitor TA protein aggregation in the cytosol, which indicates compromised Get1/2 function .

  • Biochemical Reconstitution Biochemical reconstitution helps define mutations in the Get1/2 transmembrane domain that disrupt TA protein insertion .

  • smFRET (single-molecule Förster resonance energy transfer) This technique is used to study the conformational changes in Get3 upon interaction with Get1 and Get2 .

  • Pulse-Chase Assay Pulse-chase assays are used to measure the insertion kinetics of newly synthesized TAs .

  • Immunofluorescence Microscopy Immunofluorescence microscopy is employed to determine the subcellular distribution of exogenously expressed proteins in transformed S. pombe cells .

Significance

Studies of Get1 in Schizosaccharomyces pombe contribute to understanding the mechanisms of TA protein insertion into the ER membrane, which is essential for various cellular processes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
get1; SPBC543.10; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
get1
Target Protein Sequence
MMDLIISTILLSLFIHFFDKFAKKRTIDGAYRIYVSVSNNKDLKKNKEILEQLLTVKKEL NATSSQDQFAKWARLNRKYEQLSQEWEKQSANVKIFQDTFKRVLSLFLWILTRGFRFYIQ FKESKTPVFFLPAFLLPSWALWVLSLPRSIYGSVSLTVWNFAVQKTISGIF
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. It functions as a membrane receptor for soluble Get3, which specifically binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are suitable for producing recombinant S. pombe get1?

    E. coli is the most commonly used expression system for S. pombe get1 protein . When expressing recombinant get1:

    • BL21(DE3) strain is frequently utilized for optimal expression

    • The protein can be fused with N-terminal tags like His-tag for purification

    • Expression vectors containing T7 promoters provide controllable induction

    • Growth at lower temperatures (16-25°C) after induction may improve protein folding

    Alternative expression systems include:

    Expression SystemAdvantagesLimitations
    S. pombe itselfNative post-translational modificationsLower yields than bacterial systems
    S. cerevisiaeEukaryotic processingDifferent codon usage than S. pombe
    Mammalian cellsComplex folding capabilityExpensive, time-consuming
  • What purification methods are effective for recombinant get1 protein?

    Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA columns is the method of choice for His-tagged get1 protein . The purification protocol typically involves:

    1. Cell lysis using sonication or French press in a Tris/PBS-based buffer

    2. Clarification of lysate by centrifugation (15,000g for 30 minutes)

    3. Loading supernatant onto Ni-NTA column pre-equilibrated with binding buffer

    4. Washing with binding buffer containing low imidazole (10-20mM)

    5. Elution with buffer containing higher imidazole concentration (250-500mM)

    6. Buffer exchange to remove imidazole using dialysis or gel filtration

    For membrane proteins like get1, consider adding:

    • Detergents (0.1% DDM or Triton X-100) during extraction

    • Glycerol (5-10%) in buffers to stabilize the protein

Advanced Research Questions

  • What approaches are recommended for studying get1 interactions with other proteins in the GET pathway?

    Several complementary techniques can be employed:

    • Co-immunoprecipitation: Using anti-His antibodies to pull down His-tagged get1 followed by immunoblotting or mass spectrometry to identify interacting partners.

    • Yeast two-hybrid: For detecting binary interactions, though membrane proteins like get1 may require specialized split-ubiquitin Y2H systems.

    • FRET/BRET analysis: By creating fluorescent protein fusions to study interactions in living cells.

    • Crosslinking mass spectrometry: To capture transient interactions using chemical crosslinkers followed by digestion and MS/MS analysis.

    Protein-protein interaction studies can be complemented with STRING database analysis to predict functional associations, as demonstrated in studies of other S. pombe proteins .

  • How can stable integration of tagged get1 be achieved in the S. pombe genome for localization studies?

    For stable genomic integration of tagged get1 in S. pombe, researchers should consider using Stable Integration Vectors (SIVs) that avoid creating repetitive genomic regions . The process involves:

    1. Designing homology-directed repair constructs with ~500bp homology arms flanking the integration site

    2. Selecting appropriate fluorescent tags (GFP, mCherry) that don't disrupt get1 function

    3. Using a modular vector system that includes:

      • Antibiotic resistance markers for selection

      • Promoters (native or regulated)

      • Fluorescent tags

      • Terminators

    4. Transformation protocols using lithium acetate or electroporation

    5. Selection of transformants using appropriate markers

    6. Verification of single-copy integration by PCR and Southern blotting

    This approach is superior to conventional vectors that can create unstable genomic loci .

  • What are the experimental challenges in characterizing membrane topology of get1 and how can they be addressed?

    As get1 is a membrane protein, determining its topology presents unique challenges:

    • Prediction software limitations: Computational predictions often disagree on transmembrane domain boundaries for get1.

    • Experimental approaches:

      1. Protease protection assays: Using microsomal preparations with proteases like proteinase K to determine which domains are accessible.

      2. Glycosylation mapping: Introducing N-glycosylation sites at various positions; glycosylation occurs only on lumenal domains.

      3. Cysteine accessibility methods: Using membrane-permeable vs. impermeable sulfhydryl reagents to determine cytoplasmic vs. lumenal cysteine residues.

      4. Cryo-EM: For higher-resolution structural analysis, though this requires highly pure protein preparations.

    When designing these experiments, researchers should consider that get1's function may be affected by detergents used during extraction and purification.

  • How do mutations in S. pombe get1 affect protein trafficking and cellular stress responses?

    To investigate get1 mutations:

    1. Use site-directed mutagenesis to create mutations in conserved residues or domains

    2. Integrate mutated versions into S. pombe

    3. Analyze phenotypes using:

      • Growth assays under different stressors (temperature, UPR inducers)

      • Fluorescent microscopy tracking of tail-anchored protein localization

      • Transcriptome analysis to identify altered gene expression patterns

    Studies of other S. pombe proteins have shown that creating temperature-sensitive alleles can be particularly useful for studying essential genes .

    Expression analysis can be performed using quantitative RT-PCR with primers designed specifically for get1 and control genes like act1 .

  • What approaches can be used to study the role of get1 in relation to the cell cycle in S. pombe?

    S. pombe is an excellent model for cell cycle studies, with get1 potentially playing a role in protein translocation during cell division. Research approaches include:

    1. Synchronization methods:

      • Nitrogen starvation induces G1 arrest

      • Hydroxyurea treatment causes S-phase arrest

      • Cold-sensitive nda3 mutation enables metaphase arrest

    2. Cell cycle analysis techniques:

      • Flow cytometry with propidium iodide staining

      • Live-cell imaging with tagged get1 and cell cycle markers

      • Western blotting for get1 protein levels throughout the cycle

    3. Genetic interactions:

      • Crossing get1 mutants with known cell cycle mutants (cdc mutants)

      • Synthetic genetic array (SGA) analysis to identify genetic interactions

    When analyzing results, researchers should consider the expression patterns of cell cycle regulators in S. pombe, including cyclins like Cig2 and CDK inhibitors like Rum1 .

  • How can quantitative proteomics be applied to study get1 function in S. pombe?

    Comparative proteome analysis using techniques like iTRAQ (isobaric tag for relative and absolute quantitation) can reveal global changes in protein expression resulting from get1 mutations or overexpression . The methodology includes:

    1. Sample preparation:

      • Wild-type and get1-modified strains grown under identical conditions

      • Cell lysis and protein extraction

      • Protein digestion with trypsin

    2. iTRAQ labeling of peptides from different samples

    3. LC-MS/MS analysis:

      • Multidimensional LC separation

      • MALDI-MS or ESI-MS detection

    4. Data analysis:

      • Protein identification

      • Quantitative comparison between samples

      • Pathway enrichment analysis

    This approach has successfully identified targets for improving protein production in S. pombe and could reveal how get1 influences protein trafficking pathways .

  • What are the differences between S. pombe get1 and its homologs in other organisms?

    Comparative analysis shows several key differences:

    OrganismProteinLengthKey DifferencesSimilarity to S. pombe get1
    S. cerevisiaeGet1/Mdm39215 aaLonger N-terminal domain~30% identity
    H. sapiensGET1/WRB174 aaDifferent transmembrane organization~25% identity
    C. eleganswrb-1178 aaExtended C-terminal~22% identity

    These differences highlight the importance of species-specific studies, as findings from one system may not directly translate to another . Researchers should consider:

    • Functional complementation assays to test whether homologs can rescue S. pombe get1 mutations

    • Domain-swapping experiments to identify functionally conserved regions

    • Alignment analysis to identify highly conserved residues for targeted mutagenesis

  • How can recombinant get1 protein be used to develop in vitro reconstitution systems?

    In vitro reconstitution of GET pathway components can provide mechanistic insights:

    1. Protein preparation:

      • Express and purify recombinant S. pombe get1 with appropriate tags

      • Express and purify other GET pathway components (Get2, Get3, tail-anchored substrates)

    2. Reconstitution approaches:

      • Incorporation of purified get1 into artificial liposomes

      • Co-reconstitution with Get2 to form functional translocon

      • Addition of Get3-TA protein complexes to test insertion efficiency

    3. Analysis methods:

      • Protease protection assays to verify successful membrane insertion

      • FRET-based assays to monitor interaction kinetics

      • Electron microscopy to visualize complex formation

    When designing these experiments, consider using glycerol at 6% in storage buffers to stabilize proteins during freeze-thaw cycles .

  • What genetic approaches can identify synthetic interactions with get1 in S. pombe?

    Synthetic genetic array (SGA) analysis and targeted genetic approaches can reveal functional relationships:

    1. SGA methodology:

      • Create a query strain with tagged or mutant get1

      • Cross with deletion/mutation library

      • Select double mutants

      • Score growth phenotypes to identify synthetic interactions

    2. Targeted approaches:

      • Test interactions with other components of protein trafficking machinery

      • Examine connections to cell wall integrity pathways

      • Investigate links to stress response mechanisms

    3. Analysis considerations:

      • Use appropriate statistical methods to identify significant interactions

      • Validate key hits with targeted crosses and phenotypic assays

      • Consider temperature sensitivity and growth under stress conditions

    Studies of other S. pombe proteins have demonstrated that gene deletion libraries and temperature-sensitive alleles are valuable resources for such analyses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.