Recombinant Schizosaccharomyces pombe Protein pdh1 (pdh1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is preferred, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
pdh1; SPCC1235.08c; Protein pdh1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-226
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
pdh1
Target Protein Sequence
ISIYIKVFGRSSIVTFFLLCFHLVPNALFLFPWTIITTSFVDANVFTLLSSILILSVYGV EIERSWGHKEYLLFCQFLTVIPNIAVLIPCFIAYKITDSHYLLVAIIQSTTAIQAGILTA WYQLYSCKKEESSNKFLCPLSKYLIYLFLSIHLFYVFQSFPWTYFCLAVSGTCISELYVL FVHPVVQELFHLESHTQLPI
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the pdh1 protein in S. pombe?

Pdh1 is a highly hydrophobic 226 amino acid polypeptide characterized by seven transmembrane domains. Computational structural prediction has revealed a possible C-kinase phosphorylation site within the longest hydrophilic loop of the protein . This structural arrangement suggests pdh1 functions as a membrane protein, potentially involved in cellular signaling or transport processes. The hydrophobic nature of the protein is consistent with its integration into cellular membranes, which has important implications for experimental approaches in protein isolation and characterization.

What is known about the expression pattern of pdh1 in S. pombe?

The pdh1 gene is actively transcribed as a 1400-nucleotide mRNA in vegetatively growing S. pombe cells . This expression pattern indicates that pdh1 may play a role in normal cellular growth and metabolism rather than being exclusively activated during specific developmental or stress conditions. Researchers should consider this baseline expression when designing experiments to investigate regulated expression or when creating knockout strains to study functional consequences.

What are the optimal techniques for generating recombinant pdh1 protein in S. pombe?

When generating recombinant pdh1 protein in S. pombe, researchers should consider using integrated vectors similar to those employed in other S. pombe recombinant protein studies. Based on successful approaches with other proteins, the transformation procedure should involve growing cells to mid-log phase in YES medium (approximately 4×10^6 cells/ml), followed by washing with H₂O and 0.1 M Lithium Acetate (pH 4.9) . The cells should then be resuspended in 0.1 M Lithium Acetate at a concentration of 10^9 cells/ml and incubated at 25°C for 1 hour before adding 1-5 μg of DNA and 290 μl of 50% PEG4000 .

For optimal transformation efficiency, especially when working with membrane proteins like pdh1, a heat shock at 43°C for 15 minutes following incubation is recommended . This approach has been shown to increase transformation efficiency up to 5-fold when using antibiotic-based dominant selection markers . For pdh1-specific constructs, researchers should consider using EGFP fusion techniques similar to those successfully employed for other S. pombe proteins .

How can researchers overcome challenges in purifying membrane-bound proteins like pdh1?

Purifying hydrophobic membrane proteins like pdh1 presents unique challenges due to their seven transmembrane domains. Based on established methods for similar proteins, researchers should consider:

  • Cell disruption via sonication (similar to methods used in other S. pombe protein studies)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents such as n-dodecyl-β-D-maltoside or CHAPS

  • Affinity chromatography using epitope tags fused to pdh1

When analyzing purified pdh1, Western blotting with specific antibodies raised against unique epitopes of pdh1 would be appropriate, similar to approaches used for detecting other recombinant proteins in S. pombe . The highly hydrophobic nature of pdh1 may necessitate specialized SDS-PAGE conditions to prevent protein aggregation during electrophoresis.

How can researchers effectively investigate pdh1 localization and dynamics in living cells?

To investigate pdh1 localization and dynamics, researchers should consider fusion with fluorescent proteins similar to the EGFP tagging approach used for other S. pombe proteins . Based on established techniques, N-terminal tagging may be preferable to preserve membrane insertion capability. The endogenous pdh1 gene can be modified by integrating EGFP coding sequences at the 5' end of the gene .

For dynamic studies, researchers should employ time-lapse microscopy with appropriate controls to account for the effects of cell cycle stage on protein localization. Since other S. pombe proteins show polarized distribution and actin-dependent endocytosis , researchers should consider co-localization studies with markers for various cellular compartments, particularly focusing on membrane structures, endocytic vesicles, and polarized growth regions.

A comparison table for protein localization techniques in S. pombe:

TechniqueAdvantagesLimitationsSuitability for pdh1
EGFP fusionLive cell imaging, dynamic studiesTag may affect functionGood for membrane proteins
ImmunofluorescenceNo tag needed, high specificityFixed cells onlyChallenging for membrane proteins
Fractionation & Western blotQuantitative, biochemical confirmationNo spatial resolutionGood complementary approach
Correlative light-electron microscopyUltrastructural detailComplex procedureExcellent for detailed localization

What approaches should be used to investigate potential protein interactions of pdh1?

Given pdh1's transmembrane nature and potential signaling role suggested by its C-kinase phosphorylation site , investigating protein interactions is crucial. Researchers should consider:

  • Co-immunoprecipitation with epitope-tagged pdh1, using detergents optimized for membrane protein complexes

  • Proximity-based labeling techniques (BioID or APEX) to identify transient interactions

  • Yeast two-hybrid membrane systems specifically designed for membrane proteins

  • Mass spectrometry analysis of purified pdh1 complexes

Since pdh1 contains a potential C-kinase phosphorylation site , researchers should specifically investigate interactions with kinases and phosphatases known to be active in S. pombe, such as the PP1 catalytic subunits Dis2 and Sds21 . Additionally, researchers might want to explore whether pdh1 interacts with proteins involved in polarized growth, given the importance of membrane proteins in this process in S. pombe.

What are the most effective strategies for generating pdh1 knockout or conditional mutants?

For creating pdh1 knockout strains, researchers should consider the following approaches based on established S. pombe genetic techniques:

  • Gene replacement using homologous recombination with antibiotic resistance markers

  • CRISPR-Cas9 genome editing for precise modifications

  • For conditional mutants, consider using the auxin-inducible degron (AID) system or temperature-sensitive alleles

When targeting the pdh1 locus, researchers should be aware that some S. pombe loci have low rates of gene targeting (below 5%) . In such cases, the modified transformation procedure described earlier can increase efficiency. Alternatively, removal of the pku70 gene, which is involved in non-homologous end joining, can significantly improve targeting efficiency for difficult loci .

For conditional expression systems, researchers might consider systems like those used in other S. pombe studies where genes can be regulated by environmental conditions such as nutrient availability or temperature shifts.

How can researchers determine the physiological role of pdh1 in S. pombe?

To determine pdh1's physiological role, researchers should employ multiple complementary approaches:

  • Phenotypic analysis of pdh1 deletion mutants under various growth conditions

  • Examination of pdh1 overexpression strains for morphological or growth abnormalities

  • Transcriptome and proteome analysis to identify affected pathways

  • Stress response assays (osmotic, oxidative, temperature) to identify conditions where pdh1 function becomes critical

Given that pdh1 is a membrane protein with seven transmembrane domains , researchers should pay particular attention to processes like membrane integrity, ion homeostasis, nutrient transport, and polarized growth. Since other membrane proteins in S. pombe are involved in polarized growth and stress responses , these areas warrant special attention.

How can researchers address issues with protein misfolding when working with recombinant pdh1?

Membrane proteins like pdh1, with seven transmembrane domains , are particularly prone to misfolding when overexpressed. Researchers should consider:

  • Using lower-temperature induction (25°C instead of 30°C) to slow protein synthesis and allow proper folding

  • Co-expressing chaperones known to assist membrane protein folding

  • Optimizing the signal sequence or adding fusion partners known to enhance membrane insertion

  • Using specialized host strains with modified membrane composition

When assessing proper folding, researchers should confirm correct membrane insertion through protease protection assays, glycosylation site accessibility (if appropriate tags are added), or functional assays if activity can be measured.

What are the best practices for resolving expression and solubility issues when working with pdh1?

For hydrophobic membrane proteins like pdh1, expression and solubility challenges are common. Based on experiences with other membrane proteins, researchers should consider:

  • Testing multiple detergents for optimal solubilization (e.g., DDM, CHAPS, Triton X-100)

  • Using fusion partners known to enhance membrane protein solubility

  • Employing specialized expression systems designed for membrane proteins

  • Optimizing induction conditions (temperature, duration, inducer concentration)

A systematic approach to detergent screening should be employed, as shown in this example table:

DetergentCritical Micelle Concentration (CMC)Extraction Efficiency for pdh1Protein Activity Retention
DDM0.17 mMHighHigh
CHAPS8-10 mMMediumHigh
Triton X-1000.2-0.9 mMHighMedium
SDS8.2 mMVery highLow
Digitonin0.5 mMMediumVery high

Note: The values in this table are hypothetical and should be determined experimentally for pdh1.

How might pdh1 research connect to broader studies of membrane proteins in S. pombe?

Research on pdh1 contributes to the broader understanding of membrane protein biology in S. pombe. The presence of seven transmembrane domains and a potential C-kinase phosphorylation site suggests pdh1 may function in signal transduction pathways. Researchers should consider:

  • Comparing pdh1 with other S. pombe membrane proteins involved in stress responses

  • Investigating whether pdh1 participates in pathways similar to other membrane proteins that affect polarized growth, such as those involving Wsh3/Tea4

  • Exploring potential functional redundancy with other membrane proteins

Future studies might explore whether pdh1 is involved in processes like polarized growth regulation, stress responses, or endocytosis - all functions associated with other membrane proteins in S. pombe .

What are the potential applications of structural studies of pdh1 for understanding other transmembrane proteins?

Structural studies of pdh1 could provide valuable insights into the architecture and function of seven-transmembrane domain proteins in fungi. Researchers might consider:

  • Cryo-electron microscopy for structural determination

  • X-ray crystallography (though challenging for membrane proteins)

  • NMR studies of specific domains or the soluble regions

The unique structural features of pdh1, including its hydrophobic transmembrane domains and C-kinase phosphorylation site , make it potentially valuable for comparative structural biology. Understanding the structure-function relationship in pdh1 could inform research on other membrane proteins with similar topologies, not only in S. pombe but in other organisms as well.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.