Recombinant Schizosaccharomyces pombe Protein PER1 homolog (SPAC823.07)

What are the optimal storage conditions for Recombinant S. pombe PER1 homolog protein?

The recombinant Schizosaccharomyces pombe Protein PER1 homolog (SPAC823.07) should be stored in a Tris-based buffer containing 50% glycerol that has been specifically optimized for this protein's stability. For long-term storage, maintain the protein at -20°C or preferably at -80°C for extended preservation periods . For working experiments, it is advisable to prepare small aliquots to minimize freeze-thaw cycles, as repeated freezing and thawing can significantly compromise protein integrity and activity. Working aliquots can be stored at 4°C for up to one week with minimal degradation, but avoid longer periods at this temperature . Always follow proper thawing procedures by allowing the protein to gradually reach the desired working temperature rather than employing rapid warming methods that may induce protein denaturation.

What is the amino acid sequence of the S. pombe PER1 homolog, and what functional domains does it contain?

The S. pombe PER1 homolog (SPAC823.07) amino acid sequence begins with SAGDLHPVYVSCVNRCIENKCHGNPSDTSKLPLDLKLFRWDCGSNCGYECEITAENYFAA and continues with a complete sequence that contains several notable structural features . Domain analysis reveals the presence of conserved regions that are characteristic of the PER1 protein family. The protein contains cysteine-rich motifs that suggest potential involvement in redox regulation or metal binding capabilities. The expression region spans amino acids 25-331, indicating that this represents the functional core of the protein . Comparative sequence analysis with homologs from other species highlights conserved domains that likely contribute to the protein's biological function within the cellular context of S. pombe. These structural features provide important insights for designing targeted mutations in structure-function relationship studies.

How can I verify the activity of the recombinant PER1 homolog protein after purification?

Verification of the recombinant PER1 homolog activity requires implementation of specific functional assays based on its predicted biological role. While direct activity assays for this specific protein are still under development, researchers can utilize several approaches for quality assessment. Initially, protein integrity should be confirmed through SDS-PAGE analysis to verify molecular weight and purity. Western blot analysis using antibodies specific to either the PER1 homolog or to the tag region (if applicable) provides confirmation of identity . Drawing from methodologies applied to other S. pombe proteins, researchers might consider adapting functional assays used for related proteins such as those measuring cell wall integrity effects, as seen with protein kinase C homologues . Additionally, interaction studies with potential binding partners using pull-down assays or co-immunoprecipitation can provide indirect evidence of proper protein folding and functionality. Always include appropriate positive and negative controls in these verification procedures to ensure reliable interpretations.

What expression systems are most effective for producing recombinant S. pombe PER1 homolog?

Based on research methodologies applied to similar S. pombe proteins, bacterial expression systems, particularly E. coli, have proven effective for recombinant production of fission yeast proteins. For instance, the Pac1 ribonuclease from S. pombe was successfully overexpressed in E. coli for subsequent purification and characterization . When expressing the PER1 homolog, selecting an appropriate vector system with inducible promoters (such as T7 or tac) allows controlled expression. The tag type determination should be optimized during the production process to facilitate purification while minimizing interference with protein function . For proteins where post-translational modifications are critical, eukaryotic expression systems such as yeast (S. cerevisiae) or insect cells may provide advantages over bacterial systems. Each expression strategy should include optimization of induction conditions, including temperature, inducer concentration, and duration to maximize soluble protein yield while minimizing formation of inclusion bodies.

How might the function of S. pombe PER1 homolog relate to cell integrity pathways similar to those regulated by protein kinase C homologues?

The potential relationship between the PER1 homolog and cell integrity pathways in S. pombe represents an intriguing research direction. Drawing parallels from studies on protein kinase C homologues (pck1p and pck2p), which interact with rho1p and rho2p GTPases to maintain cell integrity and regulate actin cytoskeleton polarization , investigations could examine if the PER1 homolog participates in similar or complementary pathways. Experimental approaches should include co-immunoprecipitation assays to identify potential interactions between the PER1 homolog and components of the cell integrity pathway. Gene deletion or conditional expression studies comparing phenotypes between PER1 homolog mutants and pck1/pck2 mutants could reveal functional relationships or compensatory mechanisms. Researchers should specifically investigate whether the PER1 homolog affects (1,3)beta-D-glucan synthase activity, which is a key cell wall component regulated by pck2p . Additionally, microscopy studies analyzing cytoskeletal organization and cell wall integrity in response to manipulations of PER1 homolog expression would provide valuable insights into its potential role in these fundamental cellular processes.

What experimental approaches can resolve contradictory data regarding the cellular localization of the PER1 homolog protein?

Resolving contradictory localization data for the PER1 homolog requires a multi-modal experimental approach. Begin with fluorescent protein tagging at both N- and C-termini separately, as tag position can affect localization signals. Compare results from both constructs to identify potential artifacts. Implement live-cell imaging using confocal microscopy combined with co-localization studies using established organelle markers (endoplasmic reticulum, Golgi, mitochondria, etc.) to precisely map the protein's distribution . To validate these findings, employ complementary approaches including subcellular fractionation followed by Western blotting, and immunogold electron microscopy for ultrastructural localization. For temporal dynamics, utilize time-lapse microscopy under various cellular conditions, particularly during cell cycle progression or stress responses. When contradictions persist, investigate potential post-translational modifications or alternative splicing that might direct the protein to different cellular compartments under specific conditions. The table below outlines a systematic approach for resolving localization conflicts:

How can advanced proteomics approaches be applied to identify interaction partners of the S. pombe PER1 homolog?

Advanced proteomics strategies provide powerful tools for uncovering the interaction network of the PER1 homolog. Implement BioID or APEX proximity labeling by creating fusion proteins with biotin ligase or peroxidase, respectively, which biotinylate proteins in close proximity to the PER1 homolog in living cells. This approach captures transient interactions that might be missed by traditional co-immunoprecipitation methods . Alternatively, quantitative affinity purification coupled with mass spectrometry (AP-MS) using SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling enables distinction between specific interactions and background contaminants. Cross-linking mass spectrometry (XL-MS) can further define the structural organization of identified protein complexes. For validation, implement targeted approaches such as yeast two-hybrid screens, bimolecular fluorescence complementation (BiFC), or FRET (Förster Resonance Energy Transfer) analysis. Genetic interaction screens using synthetic lethality or synthetic dosage lethality methodologies can identify functional relationships that complement physical interaction data. Integration of these various datasets using computational network analysis will provide a comprehensive understanding of the PER1 homolog's functional context within cellular processes.

How might the PER1 homolog function intersect with cell cycle regulation pathways in S. pombe, particularly during stress responses?

The potential intersection between the PER1 homolog and cell cycle regulation, especially during stress responses, represents an important research direction. Building on knowledge from studies of other S. pombe proteins like puc1, which functions in mitotic cycle exit and shows increased expression during nitrogen starvation , researchers should investigate whether the PER1 homolog exhibits similar stress-responsive regulation. Experimental approaches should include quantitative RT-PCR and Western blot analyses to monitor PER1 homolog expression levels during various stress conditions (nutrient limitation, oxidative stress, temperature shifts). Synchronization experiments can determine if expression or post-translational modifications fluctuate during specific cell cycle phases. Genetic interaction studies with known cell cycle regulators, such as puc1 or pat1, would reveal functional relationships . Creation of conditional PER1 homolog mutants would allow researchers to identify specific cell cycle phenotypes upon protein depletion or overexpression. Flow cytometry analysis of DNA content in these mutants would further characterize cell cycle progression defects. Additionally, researchers should investigate whether the PER1 homolog, like puc1, influences sexual development timing in response to environmental stressors, which represents a critical transition point between cycling and non-cycling cells in S. pombe .

What purification strategy yields the highest activity of recombinant S. pombe PER1 homolog protein?

Optimizing purification protocols for the S. pombe PER1 homolog requires careful consideration of protein characteristics to maintain structural integrity and functional activity. Based on approaches used for other S. pombe proteins like Pac1 ribonuclease , a multi-step purification strategy is recommended. Begin with affinity chromatography using the appropriate ligand based on the protein's tag (His, GST, MBP, etc.). For the PER1 homolog, the specific tag type should be determined during the production process to optimize purification efficiency . Following initial capture, implement ion exchange chromatography as a secondary purification step, selecting cation or anion exchange based on the protein's theoretical isoelectric point. Size exclusion chromatography provides a final polishing step while simultaneously providing information about the protein's oligomeric state. Throughout the purification process, buffer conditions must be carefully optimized. Maintain reducing conditions with agents like DTT or β-mercaptoethanol to protect cysteine residues that may be critical for protein function. Monitor protein activity at each purification stage using the established functional assay to identify steps that might compromise activity. For maximum stability, purify at low temperatures (4°C) and include protease inhibitors to prevent degradation.

What are the optimal conditions for conducting structure-function studies on the PER1 homolog protein?

Structure-function analysis of the PER1 homolog requires a comprehensive approach combining computational prediction with experimental validation. Begin with in silico analysis using tools like I-TASSER, AlphaFold, or Phyre2 to predict secondary and tertiary structures based on the amino acid sequence . These predictions can guide the design of truncation constructs and site-directed mutagenesis targeting conserved motifs or predicted functional domains. For experimental structure determination, assess protein stability under conditions required for X-ray crystallography, nuclear magnetic resonance (NMR), or cryo-electron microscopy. Optimize buffer conditions (pH, ionic strength, additives) through thermal shift assays or differential scanning fluorimetry to identify formulations that enhance protein stability. Functional assays should be developed to test specific hypotheses about structure-function relationships. For instance, if metal-binding is predicted based on sequence analysis, conduct activity assays in the presence of various metal ions and chelators. Circular dichroism spectroscopy can monitor changes in secondary structure under different conditions or upon substrate binding. For proteins resistant to traditional structural biology approaches, hydrogen-deuterium exchange mass spectrometry (HDX-MS) or limited proteolysis coupled with mass spectrometry can provide insights into protein dynamics and domain organization.

How can CRISPR-Cas9 genome editing be optimized for studying PER1 homolog function in S. pombe?

Implementing CRISPR-Cas9 genome editing for studying the PER1 homolog in S. pombe requires specific optimization for this organism's biological context. Design guide RNAs (gRNAs) targeting the SPAC823.07 locus using S. pombe-specific algorithms that account for this organism's genome characteristics and PAM preferences. For efficient delivery, develop expression vectors containing both Cas9 and gRNA expression cassettes with promoters active in S. pombe, such as nmt1 or adh1 . When creating knockout strains, design repair templates with appropriate homology arms (typically 500-1000 bp) flanking selectable markers. For precise edits or tag insertions, extend homology arms to 1000-1500 bp to enhance integration efficiency. Confirm successful editing through a combination of PCR genotyping, Sanger sequencing, and Western blotting. To address potential lethality if the PER1 homolog is essential, implement conditional approaches such as auxin-inducible degron (AID) systems or promoter replacements with regulatable promoters. For multiplexed editing targeting PER1 homolog alongside interacting partners, express multiple gRNAs simultaneously using polycistronic constructs or multiple expression cassettes. After generating the desired mutants, conduct comprehensive phenotypic characterization including growth rate analysis, cell morphology assessment, cell wall integrity tests, and stress response evaluations to determine the functional consequences of PER1 homolog modification.

What is the relationship between the PER1 homolog and other well-characterized proteins in S. pombe such as protein kinase C homologues or the Pac1 ribonuclease?

Investigating potential functional relationships between the PER1 homolog and other well-characterized S. pombe proteins could reveal important biological networks. To explore connections with protein kinase C homologues (pck1p and pck2p), which regulate cell integrity and cell wall biosynthesis , implement genetic interaction analyses through creation of double mutants combining PER1 homolog mutations with pck1Δ or pck2Δ. Synthetic phenotypes would suggest related but non-redundant functions. Similarly, investigate potential functional overlap with the Pac1 ribonuclease, an essential endoribonuclease in S. pombe , through genetic interaction studies and expression profiling. Biochemical approaches including co-immunoprecipitation or proximity labeling could identify physical interactions between these proteins. Perform comparative transcriptomics and proteomics analyses between wild-type and PER1 homolog mutant strains, then compare results with existing datasets for pck1/pck2 or pac1 mutants to identify overlapping gene expression signatures. For mechanistic insights, investigate whether the PER1 homolog influences pathways known to be regulated by these proteins, such as cell wall integrity signaling (pck1p/pck2p) or RNA processing (Pac1). Localization studies using fluorescent protein fusions could reveal co-localization patterns that suggest functional cooperation. Understanding these relationships would place the PER1 homolog within the broader context of S. pombe cellular regulation networks.

How might post-translational modifications regulate PER1 homolog function and what techniques can best characterize these modifications?

Post-translational modifications (PTMs) likely play crucial roles in regulating PER1 homolog function, similar to other regulatory proteins in S. pombe. A comprehensive PTM characterization workflow should begin with prediction algorithms to identify potential modification sites based on sequence analysis, focusing on common modifications like phosphorylation, acetylation, ubiquitination, and glycosylation . For experimental validation, implement mass spectrometry-based proteomics approaches including enrichment strategies specific to each modification type: titanium dioxide or IMAC for phosphopeptides, antibody-based enrichment for acetylated or ubiquitinated peptides, and lectin affinity chromatography for glycosylated forms. To determine the biological significance of identified modifications, create non-modifiable mutants (e.g., S→A for phosphorylation sites) and phosphomimetic variants (e.g., S→D/E) through site-directed mutagenesis, then assess their functional consequences through activity assays and phenotypic analysis. For dynamics of modifications during cellular processes, synchronize cells and collect samples at defined time points for PTM analysis. Alternatively, subject cells to various stress conditions to identify stress-responsive modifications. Advanced techniques like targeted proteomics (PRM or MRM) provide quantitative analysis of specific modified peptides across conditions. Complementary approaches including Western blotting with modification-specific antibodies (if available) or Phos-tag SDS-PAGE for phosphorylation analysis provide additional validation of mass spectrometry findings.

How can researchers address solubility issues when expressing recombinant S. pombe PER1 homolog protein?

Solubility challenges with recombinant PER1 homolog expression require systematic optimization strategies. If insoluble inclusion bodies form during bacterial expression, implement multiple approaches to enhance solubility. First, modify expression conditions by reducing temperature (16-20°C), decreasing inducer concentration, and extending expression time to slow protein production and facilitate proper folding . Alternatively, explore solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin, which can be later removed using specific proteases. Buffer optimization is critical - screen different pH values, salt concentrations, and additives such as glycerol, non-ionic detergents, or amino acid derivatives like arginine and glutamic acid that can stabilize proteins in solution. For proteins that remain insoluble despite these approaches, consider refolding strategies from inclusion bodies, including rapid dilution, dialysis, or on-column refolding techniques. The refolding buffer composition is crucial and may require screening of different redox conditions to establish proper disulfide bonds. For particularly challenging cases, switch to eukaryotic expression systems like S. cerevisiae, Pichia pastoris, or insect cells, which may provide appropriate chaperones and post-translational modifications for proper folding. Regardless of the approach, validate that soluble protein maintains its structural integrity and biological activity through appropriate functional assays.

What strategies can resolve unexpected results in functional assays of the PER1 homolog protein?

When unexpected results emerge in functional assays of the PER1 homolog, implement a systematic troubleshooting approach to identify potential sources of error or reveal genuine biological insights. First, verify protein quality through analytical techniques including SDS-PAGE, size exclusion chromatography, and mass spectrometry to confirm identity, purity, and integrity . Examine assay components individually, including buffers, substrates, and detection reagents, and prepare fresh solutions to eliminate degradation issues. Implement positive and negative controls in parallel to validate assay functionality. For complex reaction systems, add components sequentially while monitoring activity to identify potential inhibitory factors. Consider whether the protein requires cofactors such as metal ions or specific binding partners that might be missing from the assay. If results contradict published data, carefully review methodological differences including protein preparation, buffer composition, temperature, and detection methods. Unexpected results often reveal novel aspects of protein function - consider whether alternative substrates, unexpected pH optima, or unforeseen cofactor requirements might explain the observations. Design validation experiments that specifically test new hypotheses emerging from the unexpected results. Finally, consider biological context - the PER1 homolog may have different activities depending on cellular conditions, post-translational modifications, or interaction partners that differ between experimental systems.