Recombinant Schizosaccharomyces pombe Protein rax1 (rax1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have specific tag type preferences, please inform us and we will prioritize developing the specified tag.
Synonyms
rax1; SPAC23G3.05c; Protein rax1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
rax1
Target Protein Sequence
MASAPRVSEVLTKKNLPPLSLYNFYIYIRDEENAIEFLDLFLDIMLHKFLFREHIRGLYK AGVTSTSLNTESSSTLGPHHFTRFRSASLSLEDLSTVYWPNFGPLLLEELSNEQTINSSD LLLSKDRAAYLKNLLTSNIQSLTQESTVISKEQVKMFTQIIIEKYFNPASPHEVMLPPQL VQPILDCKEHQRQDELRLFEDVETYLLNFLLKPAYYRFLNHKFKHNLNPLTCTGRFIIGY VSTFAAYWLGFCGIFLDYSRRKRVWTLLPFAFGFYNLICTWSKHDPVLALLGYSEVKPFH YEKVLQPSIRLSLNRRAIFVLSIIVLIVGANTAIFSCVPSIRL
Uniprot No.

Target Background

Function
May be involved in cell polarization and division.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of rax1 protein in Schizosaccharomyces pombe?

Rax1 in S. pombe likely plays a critical role in cell polarity establishment and maintenance, similar to how other polarity factors function in this model organism. Based on studies of the S. pombe polarity network, rax1 would function within the complex machinery that ensures proper cell shape and growth directionality. This protein likely participates in the spatial organization of the actin cytoskeleton and may interact with small GTPases like rho1p and rho2p that are essential for polarized growth . The protein could potentially act as a "linker" between cell polarity and cell cycle regulation pathways, coordinating these processes to ensure proper cellular division . Unlike other well-characterized polarity factors in S. pombe, rax1's specific interactions and regulatory mechanisms remain less documented, creating opportunities for novel research directions exploring its precise mechanistic contributions to polarized growth.

How does rax1 compare to similar proteins in other model organisms?

While specific information about rax1 homology is not directly provided in the search results, we can infer that rax1 likely belongs to a conserved family of polarity proteins found across fungi and possibly other eukaryotes. In S. pombe, polarity proteins often show functional conservation with homologs in budding yeast (Saccharomyces cerevisiae) and sometimes with more complex eukaryotes, though the mechanisms may differ. The search results indicate that even within closely related yeasts, protein interactions can be mapped to different regions of homologous proteins, as seen with protein kinase C homologues in S. pombe versus S. cerevisiae . This suggests that while rax1 may have functional homologs in other systems, its specific interaction domains and regulatory mechanisms might differ. Understanding these evolutionary distinctions provides valuable insights into both conserved and species-specific aspects of cell polarity regulation across eukaryotes.

What protein domains and structural features characterize rax1?

Based on analysis of other S. pombe polarity proteins, rax1 likely contains domains that facilitate protein-protein interactions, membrane association, and possibly signal transduction. Similar polarity proteins in S. pombe, such as those that interact with Rho GTPases, often contain specific binding domains like HR1 motifs that are crucial for their function . Without specific structural data on rax1, researchers should investigate whether it contains known functional domains such as:

  • Membrane-targeting domains (e.g., pleckstrin homology domains)

  • Protein-protein interaction motifs

  • Regulatory regions that might be subject to phosphorylation or other post-translational modifications

  • GTPase-binding regions if it interacts with Rho-family proteins

A comparative bioinformatic analysis with other known polarity regulators would help identify conserved structural elements that might be present in rax1, guiding hypothesis generation for functional studies.

What are the optimal conditions for recombinant expression of S. pombe rax1 protein?

For optimal recombinant expression of S. pombe rax1 protein, researchers should consider both homologous (S. pombe) and heterologous (E. coli, insect cells) expression systems, each with distinct advantages. When using S. pombe as the expression host, conventional PCR-based gene targeting methods can be employed for tagging the native rax1 gene with purification tags such as His6, FLAG, or TAP . For heterologous expression, codon optimization for the host organism is essential to overcome codon bias issues that often affect expression of S. pombe proteins. Expression trials should systematically evaluate parameters including temperature (typically 18-30°C), induction time (4-24 hours), and inducer concentration to determine optimal conditions. For membrane-associated proteins like many polarity factors, addition of solubilizing agents or expression as truncated versions lacking membrane-binding domains may improve solubility. The search results indicate that researchers studying S. pombe proteins often use tagging approaches, as demonstrated with the successful tagging of Sts5 with GFP for in vivo studies . This suggests that similar approaches could be effective for rax1 expression and purification.

What purification strategies yield the highest purity and activity for recombinant rax1?

Developing an effective purification strategy for recombinant rax1 requires a multi-step approach that considers the protein's physical and biochemical properties. Based on successful purification strategies for other S. pombe proteins, a recommended protocol would include:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged protein or anti-FLAG for FLAG-tagged constructs)

  • Intermediate purification via ion exchange chromatography to remove contaminants with different charge properties

  • Polishing step using size exclusion chromatography to ensure homogeneity and remove aggregates

Purification buffers should be optimized to maintain protein stability, potentially including:

Buffer ComponentRecommended RangePurpose
Buffer (HEPES/Tris)pH 7.0-8.0Maintain optimal pH
NaCl150-300 mMReduce non-specific interactions
Glycerol5-10%Enhance stability
Reducing agent (DTT/TCEP)1-5 mMPrevent oxidation of cysteines
Protease inhibitorsAs recommendedPrevent degradation

For activity preservation, it's crucial to determine if rax1 requires specific cofactors or binding partners for stability, similar to how rho1p stabilizes pck1p and pck2p kinases in S. pombe . Functional assays should be performed at each purification step to monitor activity retention, which is particularly important for proteins involved in complex interaction networks.

How can researchers verify the proper folding and functionality of purified recombinant rax1?

Verifying proper folding and functionality of purified recombinant rax1 requires multiple complementary approaches. First, biophysical characterization using circular dichroism spectroscopy can assess secondary structure content, while thermal shift assays measure protein stability and can identify buffer conditions that enhance folding. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides information about oligomeric state and homogeneity. For functional verification, researchers should develop assays based on rax1's predicted biological role in cell polarity. If rax1 interacts with small GTPases like other polarity factors in S. pombe, GTPase binding assays could confirm functionality . Another approach is to test complementation of rax1 deletion phenotypes with the purified protein through methods such as protein microinjection or reconstitution experiments. Microscopy-based assays using fluorescently labeled proteins could assess localization patterns in vitro or in semi-permeabilized cells. As demonstrated with other S. pombe proteins, structure-function relationships can be explored through targeted mutations of predicted functional domains, followed by activity assays to identify essential regions .

What techniques are most effective for determining rax1's binding partners in S. pombe?

Identifying rax1's binding partners requires a multi-faceted approach combining both in vivo and in vitro techniques. Among the most effective methodologies, affinity purification coupled with mass spectrometry (AP-MS) stands as the gold standard for comprehensive interactome mapping. This approach involves expressing tagged rax1 in S. pombe, followed by gentle lysis and pull-down of the protein complex for mass spectrometric analysis. Based on studies of other S. pombe polarity regulators, researchers should consider crosslinking the complexes prior to purification to capture transient interactions . Yeast two-hybrid screening provides a complementary approach that can detect direct binary interactions, while proximity-based labeling methods such as BioID or APEX can identify proteins in close proximity to rax1 in living cells. For validation of specific interactions, microscopy-based techniques like Fluorescence Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC) should be employed to confirm interaction in the native cellular environment. The search results demonstrate that GTP-dependent interactions are common for polarity regulators in S. pombe, suggesting that interaction studies should examine how nucleotide-binding status affects rax1's binding profile .

How does phosphorylation or other post-translational modifications regulate rax1 activity?

Post-translational modifications (PTMs) likely play a crucial role in regulating rax1 activity, similar to their importance in other S. pombe polarity and cell cycle proteins. Phosphorylation represents a particularly important regulatory mechanism in S. pombe signaling networks, as evidenced by the complex phospho-regulation of sexual differentiation and cell cycle progression . To investigate rax1 phosphorylation, researchers should employ phospho-specific antibodies or phospho-proteomic mass spectrometry to identify modified residues under different conditions (cell cycle stages, nutrient availability, stress response). Candidate kinases for rax1 phosphorylation might include members of the PKC family (pck1p, pck2p), which are known to regulate cell polarity in S. pombe , or stress-activated protein kinases that respond to environmental changes . Site-directed mutagenesis of identified phosphorylation sites to create phospho-null (Ser/Thr to Ala) or phospho-mimetic (Ser/Thr to Asp/Glu) mutants provides a powerful approach to determine the functional significance of specific modifications. Beyond phosphorylation, researchers should also investigate other potential PTMs such as ubiquitination, which could regulate rax1 stability or localization, similar to how cell cycle regulators in S. pombe are controlled through protein degradation pathways .

What is the three-dimensional structure of rax1 and how does it relate to function?

Determining the three-dimensional structure of rax1 would provide invaluable insights into its functional mechanisms. While specific structural information about rax1 is not available in the search results, researchers can employ several complementary approaches to elucidate its structure. X-ray crystallography remains the gold standard for high-resolution protein structure determination, requiring purification of milligram quantities of homogeneous, crystallization-quality protein. For proteins resistant to crystallization, cryo-electron microscopy (cryo-EM) offers an alternative approach that has revolutionized structural biology of challenging proteins. For domain-level structural analysis, nuclear magnetic resonance (NMR) spectroscopy can provide information about smaller, independently folded regions of rax1. Based on structural studies of other polarity proteins, researchers should pay particular attention to potential conformational changes upon binding to interaction partners or nucleotides. The search results indicate that functional domains like HR1 motifs are important for interactions between polarity regulators and GTPases in S. pombe , suggesting that identification and structural characterization of similar domains in rax1 would be highly informative. Structure-guided mutagenesis experiments, targeting predicted functional surfaces or domains, should follow structural determination to establish structure-function relationships.

How does rax1 coordinate with Rho GTPases in regulating S. pombe cell polarity?

Rax1 likely interacts with Rho GTPases in S. pombe to regulate cell polarity, following patterns similar to other polarity factors in this organism. The search results indicate that Rho GTPases, particularly rho1p and rho2p, play central roles in S. pombe polarity by regulating the actin cytoskeleton and cell wall synthesis . These GTPases typically interact with effector proteins only in their GTP-bound, active state, as demonstrated with pck1p and pck2p kinases . To investigate rax1's potential coordination with Rho GTPases, researchers should first determine if rax1 binds preferentially to GTP-bound forms of rho1p or rho2p using in vitro binding assays with purified proteins. Co-localization studies using fluorescently tagged proteins can reveal whether rax1 and Rho GTPases occupy the same subcellular locations during different growth phases. Genetic interaction studies comparing single and double mutants of rax1 and Rho GTPases would reveal functional relationships, similar to how genetic interactions between pck1/pck2 and cell wall synthesis genes were identified . Given that GTPase binding dramatically stabilizes some polarity proteins in S. pombe , researchers should investigate whether rax1 stability is similarly affected by Rho GTPase binding, which would suggest a regulated protein degradation mechanism controlling rax1 function.

What experimental approaches best reveal the function of rax1 during different cell cycle phases?

Investigating rax1's function across different cell cycle phases requires time-resolved experimental approaches that can capture dynamic changes in protein activity, localization, and interactions. Live-cell imaging with fluorescently tagged rax1 (e.g., rax1-GFP) represents a powerful method to track its localization throughout the cell cycle, similar to approaches used with other S. pombe proteins like Sts5 . This should be combined with cell cycle markers such as spindle pole body components or DNA staining to precisely correlate rax1 dynamics with cell cycle progression. For more precise temporal control, researchers can utilize cell cycle synchronization through methods such as nitrogen starvation and release, which arrests S. pombe cells in G1 phase , or selective inhibition of Cdc2 kinase. Synchronized populations can then be analyzed at defined time points using biochemical and microscopy approaches. Proximity-based labeling methods with timestamps (e.g., SPOT-tag systems) would allow identification of rax1 interaction partners specific to different cell cycle phases. Researchers should also consider generating conditional mutants (temperature-sensitive or auxin-inducible degron-tagged versions) of rax1 to inactivate the protein at specific cell cycle stages, revealing phase-specific requirements. The search results demonstrate that "linker" proteins connecting different cellular processes can be identified through network analysis approaches , suggesting that similar computational methods could reveal how rax1 functions at the interface of cell polarity and cell cycle control.

How does the absence of rax1 affect S. pombe morphogenesis and cell integrity?

The absence of rax1 would likely produce specific phenotypic effects on S. pombe morphogenesis and cell integrity that could be systematically characterized through multiple approaches. Based on studies of other polarity regulators in S. pombe, researchers should first examine basic morphological parameters in rax1 deletion mutants, including cell length, width, shape, and division symmetry using both light and electron microscopy . Since polarity proteins in S. pombe often affect the actin cytoskeleton , visualization of actin structures using fluorescent phalloidin or Lifeact probes would reveal any disorganization in cytoskeletal architecture. Cell wall composition and integrity should be analyzed in detail, as many polarity regulators in S. pombe influence cell wall synthesis . Specific assays could include:

Time-lapse microscopy during key morphogenetic events (germination, new end take-off, division) would capture dynamic aspects of the phenotype that might be missed in static images. Genetic interaction studies with known polarity regulators and cell integrity pathway components would place rax1 within the broader regulatory network governing S. pombe morphogenesis .

What microscopy techniques are most informative for studying rax1 localization and dynamics?

For studying rax1 localization and dynamics in S. pombe, researchers should employ a strategic combination of advanced microscopy techniques that balance spatial resolution, temporal resolution, and physiological relevance. Super-resolution microscopy techniques like Structured Illumination Microscopy (SIM), Stimulated Emission Depletion (STED), or Single-Molecule Localization Microscopy (PALM/STORM) provide nanoscale resolution of rax1 localization patterns that conventional microscopy cannot achieve. For live-cell imaging, spinning disk confocal microscopy offers an excellent compromise between speed, resolution, and reduced phototoxicity, making it ideal for tracking rax1 dynamics over time. The search results indicate successful use of both OMX microscopy in conventional resolution mode and DeltaVision microscopy for imaging S. pombe cells with fluorescently tagged proteins . For studying protein dynamics, Fluorescence Recovery After Photobleaching (FRAP) or photoactivation approaches would reveal rax1's mobility and turnover rates at different cellular locations. To prepare S. pombe cells for imaging, researchers can follow established protocols for immobilizing cells on lectin-coated glass-bottomed dishes and maintaining them in minimal medium during imaging . Multi-color imaging with markers for cell poles, cytoskeleton, cell cycle stage, or interaction partners provides contextual information critical for interpreting rax1 localization and dynamics in relation to cellular processes.

How can genetic screens be designed to identify novel factors interacting with rax1?

Designing effective genetic screens to identify novel factors interacting with rax1 requires strategies that can detect various types of genetic interactions while minimizing false positives and negatives. Synthetic genetic array (SGA) analysis represents a powerful approach where a rax1 deletion or conditional mutant is systematically crossed with an arrayed collection of S. pombe deletion mutants to identify synthetic sick/lethal interactions or suppressor relationships. Alternatively, researchers can employ a high-throughput synthetic genetic interaction mapping approach using CRISPR-Cas9-based gene disruption in a rax1 mutant background. For more targeted screening, a multicopy suppressor screen can identify genes that, when overexpressed, rescue rax1 mutant phenotypes. The search results document successful identification of genetic interactions between polarity regulators and cell wall synthesis genes in S. pombe, suggesting similar approaches would be fruitful for rax1 . A critical consideration is the selection of appropriate screening conditions (temperature, nutrient availability, cell wall stressors) that enhance the sensitivity of the screen by revealing conditional interactions. For phenotypic readouts, high-content imaging approaches allow simultaneous assessment of multiple parameters including morphology, growth rate, and polarity marker localization. Following primary screen identification, validation through targeted crosses, plasmid-based complementation, and biochemical interaction assays is essential to confirm true genetic interactions.

What are the key considerations when designing CRISPR-Cas9 strategies for rax1 manipulation in S. pombe?

Designing effective CRISPR-Cas9 strategies for rax1 manipulation in S. pombe requires careful attention to several critical factors to ensure high editing efficiency while minimizing off-target effects. First, guide RNA (gRNA) design should prioritize target sequences with high on-target activity and minimal off-target potential, using S. pombe-specific algorithms that account for this organism's genome composition and chromatin structure. The search results indicate that conventional PCR-based gene targeting methods have been successfully used for gene tagging in S. pombe , but CRISPR-Cas9 offers advantages for generating precise edits. For homology-directed repair (HDR) templates, researchers should use approximately 500-1000 bp homology arms flanking the desired modification site, with longer arms generally yielding higher efficiency in S. pombe. Expression of Cas9 and gRNAs should be optimized using vectors with appropriate promoters for S. pombe (such as nmt1 or rrk1 promoters), and temporal control of Cas9 expression using inducible systems can reduce off-target effects. For delivery, transformation efficiency can be enhanced using lithium acetate-based methods optimized for S. pombe. After transformation, robust screening strategies combining antibiotic selection, colony PCR, and phenotypic assessment are essential for identifying correctly edited clones. When designing knock-in strategies for tagging rax1 with fluorescent proteins or epitope tags, researchers should carefully consider tag placement to minimize interference with protein function, potentially testing both N- and C-terminal fusions.

What are common challenges in studying rax1 and how can they be addressed?

Researchers studying S. pombe rax1 likely encounter several technical challenges that require strategic troubleshooting approaches. Protein expression and solubility issues frequently hamper biochemical studies of cell polarity proteins. If recombinant rax1 shows poor solubility, researchers should systematically optimize expression conditions by testing different fusion tags (MBP, SUMO, GST), reducing expression temperature, or expressing individual domains rather than the full-length protein. For proteins with low expression levels, codon optimization for the expression host or using stronger promoters can improve yields. Protein instability, which commonly affects regulatory proteins, can be addressed by including protease inhibitors throughout purification and identifying stabilizing buffer components through thermal shift assays. The search results indicate that interactions with binding partners can dramatically stabilize some S. pombe proteins , suggesting co-expression with interaction partners might improve rax1 stability. For localization studies, background fluorescence or mislocalization of tagged proteins may occur. Testing different fluorescent tags or tag positions (N-terminal vs. C-terminal) can resolve these issues, while ensuring the tagged protein complements null mutant phenotypes confirms functionality. For phenotypic analyses, redundancy with other polarity factors might mask rax1 deletion effects, necessitating the construction of double or triple mutants to reveal functions. Finally, cell-to-cell variability in S. pombe responses might obscure phenotypes when analyzing population averages, highlighting the importance of single-cell analyses.

How can contradictory results about rax1 function be reconciled in the research literature?

Reconciling contradictory results about rax1 function requires systematic analysis of methodological differences and biological context across studies. When facing conflicting findings, researchers should first carefully examine differences in experimental conditions, including strain backgrounds, growth media, temperature, and cell cycle synchronization methods. S. pombe strain variations can significantly impact phenotypes, as genetic background effects may enhance or suppress mutations . The search results demonstrate that proteins in S. pombe can have context-dependent functions, such as during different nutritional states or cell cycle phases . Researchers should therefore determine whether apparently contradictory results might actually reflect different biological contexts rather than true contradictions. Differences in protein tagging strategies (tag type, position, expression level) could also explain discrepancies in localization or interaction studies. To address contradictions experimentally, direct side-by-side comparisons using identical methodology, replication with multiple independent techniques, and quantitative rather than qualitative assessments are essential. For example, if two studies report different localization patterns for rax1, both tagged versions should be expressed in the same strain and imaged under identical conditions. Genetic approaches, such as testing whether mutations that cause different phenotypes can complement each other, can determine if apparent contradictions reflect different aspects of a protein's function rather than irreconcilable findings.

What strategies exist for studying rax1 when traditional approaches fail?

When traditional approaches to studying rax1 function encounter limitations, researchers can employ alternative strategies that leverage emerging technologies and indirect approaches. Proximity-based labeling methods like BioID or APEX provide a powerful alternative for identifying protein interactions when conventional co-immunoprecipitation fails due to weak or transient interactions. These approaches involve fusing rax1 to a biotin ligase or peroxidase that labels nearby proteins, which can then be purified and identified by mass spectrometry. For proteins that resist conventional structural determination, computational approaches such as AlphaFold2 can predict structures with remarkable accuracy, providing testable models of rax1 structure. Chemical genetics approaches using analog-sensitive kinase alleles (if rax1 has kinase activity) or anchor-away techniques can overcome limitations of conventional genetic approaches by allowing rapid, reversible protein inactivation. Single-molecule techniques such as single-molecule tracking in live cells can reveal dynamics and interactions that are masked in population-based studies. The search results demonstrate successful use of network analysis approaches to identify "linker" proteins connecting different cellular processes in S. pombe , suggesting that computational methods integrating multiple data types (transcriptomics, proteomics, genetic interactions) could reveal rax1 functions that aren't apparent from any single experimental approach. Finally, synthetic biology approaches, such as reconstituting minimal polarity systems in vitro or in heterologous cells, can isolate rax1 functions from the complexity of the intact cellular environment.

What are the most promising future research directions for understanding rax1 function?

The most promising future research directions for understanding rax1 function in S. pombe will likely emerge from integrating cutting-edge technologies with systematic genetic and biochemical approaches. Single-cell multi-omics approaches combining transcriptomics, proteomics, and metabolomics could reveal how rax1 influences cellular state more comprehensively than traditional methods focusing on isolated pathways. Cryo-electron tomography of S. pombe cells represents an exciting frontier that could visualize rax1's role in organizing cellular structures at molecular resolution within the native cellular environment. Optogenetic approaches for spatiotemporally precise activation or inhibition of rax1 would enable dissection of its acute functions separated from long-term adaptive responses. The search results highlight the value of identifying "linker" proteins that bridge different cellular processes , suggesting that positioning rax1 within the broader network of cell polarity, cell cycle, and cell wall regulation will be particularly informative. Synthetic biology approaches reconstructing minimal polarity systems with defined components including rax1 could reveal emergent properties impossible to discern in the complex cellular environment. Finally, comparative studies across multiple fission yeast species would illuminate how rax1 function has evolved and identify both conserved and species-specific aspects of its role in cell polarity. These approaches, particularly when combined in integrative studies, hold the greatest promise for comprehensive understanding of this important polarity regulator.

How does research on rax1 contribute to broader understanding of cell polarity mechanisms?

Research on rax1 in S. pombe contributes to our broader understanding of cell polarity mechanisms by providing insights into a model organism with distinct polarity regulation compared to more extensively studied systems. S. pombe's rod-shaped morphology and bipolar growth pattern offer unique advantages for studying polarity establishment, maintenance, and switching. The search results demonstrate that S. pombe employs conserved components like Rho GTPases for polarity control, but with specific adaptations in their interactions and regulation . By elucidating rax1's role within this network, researchers can identify both evolutionarily conserved principles of polarity and lineage-specific innovations. The "linker" protein concept highlighted in the search results is particularly significant, as understanding how proteins like rax1 bridge different cellular processes reveals how cells achieve coordinated regulation across multiple systems. Research on S. pombe polarity proteins has already revealed important principles about how cell cycle progression influences polarity machinery localization , and further studies on rax1 would extend this understanding. Additionally, the relatively simple genomic and cellular organization of S. pombe makes it an ideal system for developing predictive mathematical models of polarity, which could then be tested and refined in more complex organisms. By serving as both a complement and counterpoint to studies in budding yeast and animal cells, research on rax1 and other S. pombe polarity factors enriches our understanding of the diverse mechanisms that eukaryotic cells have evolved to achieve and maintain polarity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.