Recombinant Schizosaccharomyces pombe Protein svp26 (svp26)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Protein svp26

Schizosaccharomyces pombe, commonly known as fission yeast, has emerged as an important model organism in molecular and cellular biology research. The genome of S. pombe contains approximately 4940 protein-coding genes, representing the smallest number of open reading frames in any sequenced eukaryote at the time of its initial characterization . Among these genes, svp26 encodes a protein that has been identified as an evolutionarily conserved component of the early Golgi compartment.

The name svp26 stands for "Sed5 compartment vesicle protein of 26 kDa," indicating its localization to vesicles containing the SNARE protein Sed5, a marker of the early Golgi compartment . The recombinant form of this protein has been produced to facilitate biochemical and functional studies, providing valuable insights into cellular trafficking and protein localization mechanisms.

Gene Information and Conservation

The svp26 gene is designated as SPCC1795.10c in the S. pombe genome . Comparative genomic analyses have shown that svp26 is evolutionarily conserved across fungal species, with homologs present in Saccharomyces cerevisiae (where it is also known as ERV26) and other eukaryotes. This conservation suggests a fundamental role in cellular processes that has been maintained throughout evolution.

Physical and Chemical Properties

The recombinant version of S. pombe svp26 protein is typically produced with affinity tags to facilitate purification. The commercially available recombinant product features an N-terminal His-tag fusion and displays the following characteristics:

PropertyDescription
Molecular WeightApproximately 26 kDa
Length227 amino acids (full length)
Purity>90% as determined by SDS-PAGE
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Protein Retention Mechanism in Early Golgi

Immunoisolation studies of Golgi subcompartments have revealed that svp26 plays a crucial role in the retention of specific membrane proteins within the early Golgi compartments . In S. cerevisiae, and likely by extension in S. pombe, svp26 has been demonstrated to bind to itself and to other Golgi proteins, including the mannosyltransferase Ktr3.

Investigation of svp26 function through deletion analysis has shown that in the absence of svp26, a significant portion of Ktr3 becomes mislocalized to the endoplasmic reticulum instead of its normal location in the Golgi apparatus . This finding suggests that svp26 functions as a retention factor, helping to maintain the proper localization of specific membrane proteins within the Golgi compartments.

Role in Golgi Organization

The early Golgi compartment, marked by the SNARE protein Sed5, represents an important sorting station within the secretory pathway. As a component of this compartment, svp26 contributes to maintaining the structural and functional integrity of the Golgi apparatus. The specific interaction between svp26 and other Golgi proteins suggests a role in organizing protein complexes within these membrane compartments.

Recombinant Expression Systems

Recombinant S. pombe svp26 protein is typically produced in bacterial expression systems, particularly Escherichia coli . The expression construct includes the full-length protein sequence (amino acids 1-227) fused to an N-terminal histidine tag to facilitate purification. The resulting recombinant protein maintains the structural and functional properties of the native protein while providing additional features for research applications.

Reconstitution Protocol

For experimental use, the recombinant protein should be reconstituted following these guidelines:

  1. Briefly centrifuge the vial prior to opening

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% for long-term storage

  4. Standard recommendation is 50% glycerol final concentration

Protein Interaction Studies

Recombinant svp26 serves as a valuable tool for investigating protein-protein interactions within the Golgi apparatus. Immunoprecipitation experiments using tagged versions of the protein have already identified interactions with mannosyltransferase Ktr3 and with itself . Further studies may reveal additional binding partners and help elucidate the comprehensive interaction network within the early Golgi compartment.

Heterologous Protein Expression

The development of protein expression systems in S. pombe has encountered challenges related to proteolytic degradation of recombinant products . Understanding the role of svp26 in protein trafficking and Golgi organization could potentially contribute to improving heterologous protein production in this organism, especially for proteins that transit through the secretory pathway.

Comparative Analysis with Other Species

The conservation of svp26 across fungal species presents opportunities for comparative studies to identify shared and unique features. The availability of recombinant versions of both S. pombe svp26 and S. cerevisiae SVP26 facilitates direct comparisons of their biochemical properties and functions, potentially revealing evolutionary adaptations in Golgi organization.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
svp26; SPCC1795.10c; Protein svp26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
svp26
Target Protein Sequence
MIVLNALSYLGIVLGFIGMTVSIASALYYISEFVEEHSRLAKAFLCRLVYFIMAVMVFLV IFDGFPFWLSAFSIFSHYIYKINFDTFPFFSFKRMRFLLACFLIVANHILWVRFFQVHEF PIKPRGLTYDFVGQRLLTSRASFSQVASFMGVCVWSVPIGIFVSFTAADNTLPTITTPSS SSPDAYSSGSSRRTSNVLRQAYKKLGIFVERSLTSLGLSDRSSERYV
Uniprot No.

Target Background

Function
Svp26 may play a role in retaining a subset of membrane proteins within the early Golgi compartments.
Database Links
Protein Families
SVP26 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is svp26 protein in Schizosaccharomyces pombe?

The svp26 protein in S. pombe is identified as "Sed5 Vesicle Protein" with gene identifier SPCC1795.10c . Based on its nomenclature, svp26 appears to be involved in vesicular trafficking processes associated with the Sed5 compartment. In the related yeast Saccharomyces cerevisiae, the homologous protein (SVP26/ERV26) is described as "Sed5 compartment vesicle protein of 26 kDa" . This naming convention suggests conservation of function between the two yeast species, with both proteins likely playing roles in membrane trafficking pathways.

Sed5 is a t-SNARE protein involved in vesicular transport between the endoplasmic reticulum and Golgi apparatus. As a "Sed5 Vesicle Protein," svp26 likely participates in these trafficking events, potentially in cargo selection, vesicle formation, or membrane fusion processes.

What expression systems are available for producing recombinant svp26?

According to the available data, recombinant svp26 can be produced using several expression systems:

Expression SystemAdvantagesLimitationsTypical Purity
E. coliHigh yield, cost-effective, rapid expressionLacks eukaryotic post-translational modifications≥85% by SDS-PAGE
YeastEukaryotic PTMs, proper folding environmentModerate yield, longer expression time≥85% by SDS-PAGE
BaculovirusComplex eukaryotic PTMs, good for membrane proteinsTechnical complexity, higher cost≥85% by SDS-PAGE
Mammalian CellMost authentic PTMs, proper foldingLower yield, highest cost≥85% by SDS-PAGE
Cell-Free ExpressionRapid, good for toxic proteinsLimited PTMs, potentially costly reagents≥85% by SDS-PAGE

The choice of expression system should be guided by the specific experimental requirements. For structural studies where high yields are necessary but post-translational modifications are less critical, bacterial expression might be sufficient. For functional studies requiring authentic modifications and proper folding, eukaryotic systems would be more appropriate.

How does recombinant svp26 protein differ from native svp26?

Recombinant svp26 differs from native svp26 in several important aspects:

  • Expression context: Recombinant svp26 is produced in heterologous expression systems (E. coli, yeast, baculovirus, or mammalian cells) , whereas native svp26 is expressed in its endogenous S. pombe cellular environment.

  • Protein modifications: Depending on the expression system, recombinant svp26 may lack post-translational modifications present in the native protein, or contain modifications not typically found in S. pombe.

  • Fusion tags: Recombinant versions often contain affinity tags (His, GST, etc.) for purification purposes, which are absent in the native protein.

  • Purity: Commercial recombinant preparations achieve ≥85% purity as determined by SDS-PAGE , whereas native svp26 exists within a complex cellular milieu of proteins and other biomolecules.

  • Functional context: Native svp26 functions within its normal membrane environment and protein interaction network, which may not be fully recapitulated in recombinant systems.

These differences should be considered when designing experiments and interpreting results, particularly for functional studies.

How is the purity of recombinant svp26 determined?

The purity of recombinant svp26 is primarily assessed using SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis). According to commercial specifications, recombinant svp26 preparations should achieve greater than or equal to 85% purity as measured by this method . This technique separates proteins based on molecular weight, allowing visualization of the target protein band and any contaminants.

For more comprehensive quality assessment, researchers might consider:

  • Western blotting to confirm identity using specific antibodies against svp26

  • Mass spectrometry for detailed characterization and identification of contaminants

  • Size exclusion chromatography to assess aggregation states and oligomerization

  • Activity assays to verify functional integrity

  • Circular dichroism to evaluate secondary structure and proper folding

These additional methods provide more detailed information about protein quality beyond simple purity measurements.

What methodologies are recommended for studying svp26 function in S. pombe?

Investigating svp26 function in S. pombe requires multiple complementary approaches:

  • Gene manipulation: S. pombe has well-established protocols for gene deletion, mutation, and tagging. The fission yeast system offers powerful in vivo genetic assays that can be adapted to study svp26 function.

  • Localization studies: Fluorescent protein fusions can reveal the subcellular distribution of svp26. Given its predicted role in vesicle trafficking, colocalization with organelle markers would provide valuable insights into its function.

  • Protein-protein interactions: Co-immunoprecipitation using available antibodies against svp26 can identify interaction partners. Techniques like yeast two-hybrid, BioID proximity labeling, or mass spectrometry following immunoprecipitation would reveal the svp26 interaction network.

  • Phenotypic analysis: Characterizing the consequences of svp26 deletion or overexpression. Research on other S. pombe proteins has shown that overexpression can sometimes reveal phenotypes not apparent in deletion studies, as observed with the sptrz2+ gene whose overexpression causes lethality and morphological abnormalities .

  • Vesicle trafficking assays: Since svp26 is predicted to function in vesicular transport, cargo trafficking assays would be particularly informative, tracking the movement of model cargo proteins in wild-type versus svp26 mutant cells.

  • Ultrastructural analysis: Electron microscopy to examine changes in organelle morphology and vesicle populations in svp26 mutants.

How does svp26 in S. pombe compare functionally to its homologs in other organisms?

The comparison between svp26 and its homologs reveals important evolutionary insights:

FeatureS. pombe svp26S. cerevisiae SVP26/ERV26
Gene IdentifierSPCC1795.10c YHR181W
Alternative NamesSed5 Vesicle Protein Sed5 compartment vesicle protein of 26 kDa, Erv26p
Predicted FunctionVesicular traffickingVesicular trafficking
Associated CompartmentSed5 compartmentSed5 compartment
Available AntibodiesRabbit polyclonal Rabbit polyclonal
Antibody ApplicationsELISA, Western Blot ELISA, Western Blot

While detailed functional comparison data is limited in the available search results, we can infer that:

  • The presence of homologs across different yeast species suggests functional conservation in vesicular transport systems.

  • Both proteins are associated with Sed5, a t-SNARE involved in ER-to-Golgi transport, indicating roles in early secretory pathway trafficking.

  • Despite the divergent evolution between fission yeast (S. pombe) and budding yeast (S. cerevisiae), the conservation of this protein suggests its fundamental importance in eukaryotic cell biology.

For comprehensive functional comparison, researchers should consider complementation studies to determine if one homolog can rescue defects caused by deletion of the other.

What experimental considerations are important when using antibodies against S. pombe svp26?

When using polyclonal antibodies against S. pombe svp26, researchers should consider:

  • Specificity validation: Confirm the antibody specifically recognizes svp26 using positive controls (wild-type cells) and negative controls (svp26 deletion strains). Western blotting should show a single band of the expected molecular weight.

  • Validated applications: The available antibodies have been tested for ELISA and Western Blot applications . Researchers should thoroughly validate these antibodies if planning to use them for other applications such as immunofluorescence or immunoprecipitation.

  • Cross-reactivity assessment: If studying both S. pombe and S. cerevisiae, researchers should test for potential cross-reactivity between antibodies targeting the homologous proteins. Despite sequence similarity, epitope accessibility may differ.

  • Antibody characteristics: The antibodies available are rabbit polyclonal antibodies purified by antigen-affinity methods , which influences their specificity and application range. Polyclonal antibodies recognize multiple epitopes, potentially increasing sensitivity but also the risk of non-specific binding.

  • Experimental optimization: Conditions including antibody dilution, incubation time/temperature, and blocking agents will need optimization for each specific application and experimental system.

  • Secondary antibody selection: Choose appropriate secondary antibodies based on the detection method (fluorescent, enzymatic, etc.) and confirm they don't cross-react with yeast proteins.

How can researchers design experiments to study the role of svp26 in vesicular trafficking?

To investigate svp26's role in vesicular trafficking, researchers could implement these experimental approaches:

  • Colocalization studies:

    • Generate fluorescently tagged svp26 constructs

    • Co-express with markers for different compartments (ER, Golgi, endosomes, vesicles)

    • Perform live-cell imaging to track svp26-containing structures

  • Cargo trafficking assays:

    • Monitor transport of model cargo proteins (e.g., carboxypeptidase Y, acid phosphatase) in wild-type vs. svp26 mutant cells

    • Assess secretion rates using pulse-chase experiments

    • Examine glycosylation patterns of secreted proteins to identify transport delays

  • Genetic interaction screening:

    • Create double mutants combining svp26 deletion with mutations in known trafficking components

    • Look for synthetic phenotypes suggesting functional relationships

    • Perform high-throughput genetic interaction mapping using S. pombe deletion libraries

  • Biochemical characterization:

    • Isolate vesicle fractions and analyze protein composition

    • Compare vesicle populations between wild-type and svp26 mutant cells

    • Perform in vitro vesicle budding assays with purified components

  • Epistasis analysis:

    • Determine the hierarchical relationship between svp26 and other trafficking components

    • Use double mutant analysis and overexpression studies

    • Place svp26 within the established trafficking pathways

These approaches would provide complementary insights into svp26 function within the cellular trafficking network.

What methods are recommended for functional complementation studies involving svp26?

For functional complementation studies with svp26, researchers should consider these methodological approaches:

  • Expression construct design:

    • Clone the wild-type svp26+ gene into appropriate S. pombe expression vectors

    • Create variants with specific mutations or domain deletions to map functional regions

    • Consider both constitutive promoters for consistent expression and regulated promoters (e.g., nmt1) for controlled induction

    • Include epitope tags if protein detection is needed, preferably at positions less likely to disrupt function

  • Genetic background preparation:

    • Generate an svp26 deletion strain as the background for complementation

    • Confirm the deletion phenotype before proceeding with complementation

    • Consider creating conditional alleles (temperature-sensitive mutations) if deletion is lethal

  • Transformation approaches:

    • Use standard S. pombe transformation methods as outlined in basic protocols for fission yeast

    • Choose between integration at the native locus versus ectopic expression based on experimental goals

    • For integration, consider using CRISPR/Cas9 systems adapted for S. pombe

  • Phenotypic assays:

    • Design assays specific to the predicted function in vesicular trafficking

    • Include appropriate controls (empty vector, wild-type cells)

    • Quantify the degree of complementation under various conditions

  • Cross-species complementation:

    • Test whether the S. cerevisiae SVP26/ERV26 can complement S. pombe svp26 deletion

    • This approach provides insights into functional conservation across species

    • Create chimeric proteins to map species-specific functional domains

Complementation studies provide powerful insights into protein function by directly linking genotype to phenotype.

What are common challenges when working with recombinant S. pombe proteins and how can they be addressed?

Researchers working with recombinant S. pombe proteins like svp26 frequently encounter these challenges:

  • Protein solubility issues:

    • Challenge: Recombinant proteins may form inclusion bodies or aggregate, particularly membrane-associated proteins

    • Solution: Optimize expression conditions (lower temperature, reduced induction), use solubility-enhancing fusion tags (MBP, SUMO), or develop refolding protocols from inclusion bodies

  • Post-translational modifications:

    • Challenge: Bacterial expression systems lack eukaryotic modification machinery

    • Solution: Use eukaryotic expression systems (yeast, insect, or mammalian cells) when modifications are critical for function

  • Purification difficulties:

    • Challenge: Achieving sufficient purity for subsequent applications

    • Solution: Implement multi-step purification strategies, consider affinity tags followed by secondary purification steps like ion exchange or size exclusion chromatography

  • Protein stability:

    • Challenge: Maintaining protein stability during purification and storage

    • Solution: Optimize buffer conditions (pH, salt concentration, reducing agents), include stabilizing additives (glycerol), and store in small aliquots to avoid freeze-thaw cycles

  • Functional verification:

    • Challenge: Confirming that recombinant protein retains native activity

    • Solution: Develop activity assays based on predicted function, compare activity across different expression systems

  • Low expression yields:

    • Challenge: Insufficient protein production for experimental needs

    • Solution: Optimize codon usage for the expression host, try different promoters or induction conditions, or scale up culture volume

Systematic optimization of expression and purification conditions is often necessary for successful work with recombinant proteins.

How can researchers validate the functionality of purified recombinant svp26?

Validating the functionality of purified recombinant svp26 requires multiple approaches:

  • Structural integrity assessment:

    • Use circular dichroism spectroscopy to confirm proper secondary structure

    • Employ thermal shift assays to assess protein stability

    • Consider limited proteolysis to verify domain organization

  • Binding assays:

    • Test interaction with known or predicted binding partners (e.g., Sed5)

    • Use surface plasmon resonance, microscale thermophoresis, or pull-down assays

    • Verify interactions identified in vivo using purified components

  • Complementation studies:

    • Introduce the purified protein into permeabilized svp26-deficient cells

    • Assess rescue of trafficking defects

    • Compare activity of different recombinant versions produced in various expression systems

  • In vitro vesicle assays:

    • Test incorporation into artificial membrane systems

    • Assess influence on vesicle formation or fusion in reconstituted systems

    • Measure interaction with lipid membranes of different compositions

  • Activity comparisons:

    • Compare activities of recombinant protein versus native protein immunoprecipitated from S. pombe

    • Develop quantitative assays to measure specific activities

These validation approaches ensure that experimental findings with recombinant proteins accurately reflect the native protein's function.

What methodological approaches are recommended for studying membrane-associated proteins like svp26 in S. pombe?

Membrane-associated proteins require specialized approaches:

  • Protein extraction optimization:

    • Use appropriate detergents for solubilization (e.g., mild non-ionic detergents like digitonin or DDM)

    • Optimize buffer conditions to maintain membrane protein structure

    • Consider membrane fractionation to enrich for specific compartments

  • Localization studies:

    • Use C-terminal tags where possible to avoid disrupting N-terminal targeting signals

    • Employ markers for different membrane compartments to determine precise localization

    • Consider super-resolution microscopy techniques for detailed localization

  • Interaction studies:

    • Use crosslinking approaches to capture transient interactions

    • Consider proximity labeling methods (BioID, APEX) to identify neighboring proteins in the membrane environment

    • Validate interactions using co-immunoprecipitation with membrane-appropriate detergents

  • Functional assays:

    • Develop assays specific to membrane trafficking

    • Consider in vitro reconstitution with liposomes

    • Use vesicle isolation techniques to study protein distribution

  • S. pombe-specific considerations:

    • Leverage the well-characterized genetic toolbox available for fission yeast

    • Use the powerful in vivo genetic assays developed for S. pombe

    • Consider comparative approaches with S. cerevisiae, where membrane trafficking has been extensively studied

These specialized approaches account for the unique challenges of working with membrane-associated proteins in the S. pombe model system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.