Recombinant Schizosaccharomyces pombe Protein sym1 (sym1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Schizosaccharomyces pombe Protein sym1 (sym1)

Recombinant Schizosaccharomyces pombe Protein sym1 (sym1) is a protein derived from the fission yeast Schizosaccharomyces pombe . S. pombe is favored as a model organism because it shares several features with human cells, such as gene structure, chromatin dynamics, and control of gene expression . Sym1, also known as protein sym1, is encoded by the sym1 gene and has the ORF name SPAC3G6.05 .

Key Features and Characteristics

FeatureDescription
SourceSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Protein NamesProtein sym1
Gene Namessym1
ORF NamesSPAC3G6.05
Expression Region1-206 amino acid sequence
AA SequenceMFSRFATRYNALFEKAPIMTMCLTAGTLGGISDAVAQGLTIYQTNKNAMIGLDGVRLNTHPEIPSIKRVLQFVTFGFAISPFQFRWLRLLSAKFPIEKGAINVVKRVLLDQAVFAPFGT AFFFSWMTLAEGKGFRGAYDKLQAVFWPTLKANYMVWPFFQTVNFWLMPLQYQMPFACTVAIFWNIFLSLKNASSMQESGSQEIELF
UniProt No.O14142

Research Findings and Functions

While the specific functions of sym1 are not detailed in the provided documents, research on S. pombe has revealed much about the function of various proteins. For example, the S. pombe protein kinase C homologues, pck1p and pck2p, interact with rho1p and rho2p, influencing cell integrity and cell wall biosynthesis . Additionally, S. pombe utilizes transcription factors like spFep1 and spPhp4, regulated by spGrx4, to maintain iron homeostasis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
sym1; SPAC3G6.05; Protein sym1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
sym1
Target Protein Sequence
MFSRFATRYNALFEKAPIMTMCLTAGTLGGISDAVAQGLTIYQTNKNAMIGLDGVRLNTH PEIPSIKRVLQFVTFGFAISPFQFRWLRLLSAKFPIEKGAINVVKRVLLDQAVFAPFGTA FFFSWMTLAEGKGFRGAYDKLQAVFWPTLKANYMVWPFFQTVNFWLMPLQYQMPFACTVA IFWNIFLSLKNASSMQESGSQEIELF
Uniprot No.

Target Background

Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the sym1 protein in Schizosaccharomyces pombe?

Sym1 in S. pombe is believed to function similarly to other conserved fission yeast proteins involved in critical cellular processes. While specific sym1 data is limited, research on analogous S. pombe proteins indicates potential roles in cellular pathways. For example, proteins like pyp1 regulate signal transduction by inactivating the sty1/spc1 mitogen-activated protein kinase (MAPK) pathway . Similarly, proteins such as Yab8p show involvement in essential processes like pre-mRNA splicing and are structurally related to proteins in higher eukaryotes . To determine sym1's specific function, researchers should consider combining knockout studies with protein localization techniques and interaction analyses using methods analogous to those applied for other S. pombe proteins.

What cloning strategies are recommended for sym1 expression in S. pombe?

For optimal sym1 expression in S. pombe, consider genomic library approaches similar to those used for other S. pombe proteins. The recommended method involves:

  • Creating genomic libraries using appropriate restriction enzymes (HindIII or Sau3AI partial digests have proven successful for other proteins)

  • Transforming into a relevant S. pombe strain

  • Screening transformants for the desired phenotype

  • Isolating plasmid DNA using established protocols like the "smash and grab" method

When designing expression vectors, the nmt1 promoter system is commonly used for protein overexpression in S. pombe, though this system may not allow precise determination of upper expression limits. For more controlled expression studies, consider genetic 'tug-of-war' (gTOW) vectors which provide measurable expression levels through selectable markers and GFP reporters .

How can I confirm successful expression of recombinant sym1 protein?

To confirm successful expression of recombinant sym1 protein, implement a multi-step verification process:

Verification MethodTechnique DetailsExpected Outcome
Molecular DetectionWestern blot with specific antibodiesProtein band at expected molecular weight
Functional AnalysisActivity assays based on predicted functionMeasurable biochemical activity
LocalizationFluorescence microscopy (if GFP-tagged)Expected subcellular distribution
Mass SpectrometryLC-MS/MS of purified proteinPeptide sequences matching sym1

The use of GFP-tagged vectors is particularly valuable, as they allow monitoring of expression levels via flow cytometry or fluorescence microscopy, similar to techniques used for other S. pombe proteins . For antibody generation, consider developing polyclonal antibodies against specific regions of sym1, as was successfully done for analyzing Sen1 protein in S. pombe .

What are the optimal conditions for purifying recombinant sym1 protein from S. pombe?

Purification of recombinant sym1 from S. pombe should be approached systematically, drawing from successful purification strategies used for other S. pombe proteins. Based on established methods for polynucleotide-dependent ATPases in S. pombe , consider the following protocol:

  • Create large-scale S. pombe cultures expressing sym1 under appropriate induction conditions

  • Harvest cells at mid-log phase and prepare cell-free extracts using mechanical disruption

  • Implement a multi-step purification strategy:

    • Initial clarification by differential centrifugation

    • Ammonium sulfate precipitation (determine optimal percentage empirically)

    • Ion exchange chromatography (test both anion and cation exchange)

    • Affinity chromatography if specific interactions are known

    • Size exclusion chromatography as a final polishing step

Determine protein purity using SDS-PAGE and confirm identity by Western blotting or mass spectrometry. For difficult-to-express proteins, consider using fusion tags (His, GST, or MBP) with engineered protease cleavage sites. Monitor activity throughout purification to ensure the recombinant protein maintains its functional integrity.

How can I determine the upper limit of sym1 overexpression that S. pombe cells can tolerate?

  • Clone sym1 into gTOW vectors with different promoter strengths

  • Transform these constructs into appropriate S. pombe strains

  • Measure plasmid copy numbers using real-time PCR to quantify gene dosage

  • Correlate copy numbers with growth phenotypes to determine tolerance thresholds

  • Use flow cytometry to analyze GFP expression as a proxy for protein levels

This approach has successfully determined overexpression limits for numerous cell-cycle regulators in S. pombe. The data can be used to build mathematical models predicting cellular responses to different sym1 expression levels, similar to the integrative models developed for cell-cycle regulation .

What protein-protein interaction methods are most effective for identifying sym1 binding partners in S. pombe?

To comprehensively identify sym1 binding partners, employ complementary approaches that address both direct and indirect interactions:

MethodApplicationAdvantagesLimitations
Yeast Two-HybridScreen for direct interactionsHigh-throughput capabilityMay miss context-dependent interactions
Co-immunoprecipitationVerify interactions in vivoPreserves native conditionsRequires specific antibodies
Proximity-based labeling (BioID)Identify proximal proteinsCaptures transient interactionsMay identify non-specific interactions
Genetic interaction mappingFunctional relationshipsReveals pathway connectionsIndirect evidence of physical interaction

When designing these experiments, consider the approach used to study Yab8p-Yip1p interactions in S. pombe, which successfully demonstrated functional homology to SMN-SIP1 interactions in higher eukaryotes . For genetic studies, conditional knock-out strains can be particularly valuable for essential proteins, allowing controlled depletion of sym1 while monitoring effects on potential interaction partners.

How should I interpret conflicting data about sym1 function from different experimental approaches?

When faced with conflicting data regarding sym1 function, implement a systematic analytical framework:

  • Evaluate methodological differences between studies:

    • Expression systems and promoter strength variations

    • Strain background genetic differences

    • Experimental conditions (temperature, media, stressors)

    • Detection methods and their sensitivity

  • Consider protein context factors:

    • Post-translational modifications affecting function

    • Subcellular localization differences

    • Presence of interacting partners

    • Protein stability and turnover rates

  • Analyze functional redundancy:

    • Test for genetic interactions with related genes

    • Examine phenotypes in single versus double mutants

    • Consider bifurcations in downstream pathways, as seen with pyp1's regulation of multiple processes through the MAPK pathway

Resolution often requires integrating multiple lines of evidence rather than privileging a single experimental approach. Create a comprehensive model that accounts for conditional functionality, similar to how pyp1's regulatory roles in fbp1 transcription, sexual development, and mitosis were reconciled through careful pathway analysis .

What mathematical modeling approaches are suitable for understanding sym1's role in cellular pathways?

Mathematical modeling of sym1's role should build upon established approaches for S. pombe cellular pathway analysis. Consider implementing:

  • Ordinary differential equation (ODE) models:

    • Develop rate equations for sym1 interactions

    • Incorporate known regulatory mechanisms

    • Optimize parameters through experimental data fitting

    • Test model robustness against overexpression data

  • Stochastic simulation algorithms:

    • Account for natural variation in protein levels

    • Model low-abundance interactions more accurately

    • Predict phenotypic variability in cell populations

  • Network-based approaches:

    • Integrate sym1 into existing pathway models

    • Identify network motifs and feedback loops

    • Predict system-level responses to perturbations

The approach used for modeling cell-cycle regulation in S. pombe provides an excellent template, where a basic model was refined to incorporate gTOW-derived overexpression limits . This integrated approach successfully predicted cellular phenotypes and gene function, demonstrating the power of combining mathematical modeling with experimental data for understanding protein function in complex cellular contexts.

How can sym1 be utilized as a model for studying homologous proteins in higher eukaryotes?

Sym1 in S. pombe can serve as a powerful model system for studying homologous proteins in complex organisms by leveraging the experimental advantages of yeast while maintaining functional relevance. To establish this model:

  • Perform thorough sequence and structural analysis to identify conserved domains and motifs across species

  • Conduct complementation experiments by expressing human homologs in sym1-deficient S. pombe

  • Generate chimeric proteins combining domains from S. pombe sym1 and human counterparts to map functional regions

  • Create targeted mutations in conserved residues to establish structure-function relationships

This approach has been successfully demonstrated with Yab8p, which was shown to be functionally related to the human SMN protein involved in spinal muscular atrophy. The conservation of interaction modes between Yab8p-Yip1p and SMN-SIP1 provided valuable insights into protein function across species . Similarly, sym1 research could yield insights applicable to human disease mechanisms involving homologous proteins.

What are the most promising approaches for studying sym1's role in DNA damage response pathways?

To investigate sym1's potential involvement in DNA damage response pathways, consider implementing a comprehensive experimental strategy inspired by studies of other S. pombe proteins in this context:

  • Generate conditional and null mutants of sym1 using CRISPR-Cas9 or traditional gene replacement

  • Evaluate sensitivity to DNA-damaging agents (UV, MMS, hydroxyurea, ionizing radiation) with survival assays

  • Examine genetic interactions with established DNA repair factors through double mutant analysis

  • Analyze recruitment to sites of damage using live-cell imaging with fluorescently tagged sym1

  • Implement ChIP-seq to identify potential DNA binding sites following damage induction

This approach should draw on methodologies used to study rrp1 and rrp2 proteins in S. pombe, which were found to function in the Srs2- and Swi5/Sfr1-dependent pathway in response to DNA damage . The resulting data would position sym1 within the broader context of cellular responses to genotoxic stress.

How might integrating proteomics and genomics approaches advance our understanding of sym1 function?

Integrating multi-omics approaches offers transformative potential for comprehensively understanding sym1 function:

  • Proteome-wide interaction mapping:

    • Systematic affinity purification-mass spectrometry (AP-MS)

    • Cross-linking mass spectrometry to capture transient interactions

    • Protein correlation profiling across cellular fractions

  • Genomic profiling under sym1 perturbation:

    • RNA-seq to identify transcriptional changes

    • ChIP-seq if DNA interactions are suspected

    • ATAC-seq to examine chromatin accessibility changes

  • Integrated data analysis:

    • Network construction combining protein-protein and genetic interactions

    • Pathway enrichment analysis across conditions

    • Machine learning approaches to identify patterns across datasets

This integrated approach would position sym1 within its complete functional context, similar to how comprehensive studies of cell cycle regulators in S. pombe have yielded systems-level understanding of regulatory networks . The resulting model would facilitate hypothesis generation for targeted functional studies and potentially reveal unexpected roles for sym1 in cellular processes.

What considerations are important when designing CRISPR-based strategies for sym1 manipulation in S. pombe?

When designing CRISPR-based strategies for sym1 manipulation, researchers should consider the following critical factors:

  • Guide RNA design:

    • Use S. pombe codon optimization for Cas9 expression

    • Select target sites with minimal off-target potential

    • Verify guide efficiency in silico before implementation

    • Consider multiple guides for difficult loci

  • Repair template design:

    • Include sufficiently long homology arms (500-1000bp)

    • Incorporate silent mutations in PAM sites to prevent re-cutting

    • Consider the impact of tags on protein function and localization

    • Include selectable markers for efficient screening

  • Experimental validation:

    • Confirm edits by sequencing

    • Verify protein expression/absence by Western blotting

    • Compare phenotypes with traditional gene deletion methods

    • Check for off-target effects in key pathways

  • Special considerations for essential genes:

    • Design conditional systems (e.g., auxin-inducible degrons)

    • Create partial loss-of-function alleles

    • Consider diploid-based approaches for initial manipulations

These strategies build upon established genetic manipulation techniques in S. pombe while leveraging cutting-edge genome editing technologies to achieve precise and controlled manipulation of sym1, facilitating detailed functional characterization in various cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.