Recombinant Schizosaccharomyces pombe Protein sym1 (sym1) is a protein derived from the fission yeast Schizosaccharomyces pombe . S. pombe is favored as a model organism because it shares several features with human cells, such as gene structure, chromatin dynamics, and control of gene expression . Sym1, also known as protein sym1, is encoded by the sym1 gene and has the ORF name SPAC3G6.05 .
| Feature | Description |
|---|---|
| Source | Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Protein Names | Protein sym1 |
| Gene Names | sym1 |
| ORF Names | SPAC3G6.05 |
| Expression Region | 1-206 amino acid sequence |
| AA Sequence | MFSRFATRYNALFEKAPIMTMCLTAGTLGGISDAVAQGLTIYQTNKNAMIGLDGVRLNTHPEIPSIKRVLQFVTFGFAISPFQFRWLRLLSAKFPIEKGAINVVKRVLLDQAVFAPFGT AFFFSWMTLAEGKGFRGAYDKLQAVFWPTLKANYMVWPFFQTVNFWLMPLQYQMPFACTVAIFWNIFLSLKNASSMQESGSQEIELF |
| UniProt No. | O14142 |
While the specific functions of sym1 are not detailed in the provided documents, research on S. pombe has revealed much about the function of various proteins. For example, the S. pombe protein kinase C homologues, pck1p and pck2p, interact with rho1p and rho2p, influencing cell integrity and cell wall biosynthesis . Additionally, S. pombe utilizes transcription factors like spFep1 and spPhp4, regulated by spGrx4, to maintain iron homeostasis .
KEGG: spo:SPAC3G6.05
STRING: 4896.SPAC3G6.05.1
Sym1 in S. pombe is believed to function similarly to other conserved fission yeast proteins involved in critical cellular processes. While specific sym1 data is limited, research on analogous S. pombe proteins indicates potential roles in cellular pathways. For example, proteins like pyp1 regulate signal transduction by inactivating the sty1/spc1 mitogen-activated protein kinase (MAPK) pathway . Similarly, proteins such as Yab8p show involvement in essential processes like pre-mRNA splicing and are structurally related to proteins in higher eukaryotes . To determine sym1's specific function, researchers should consider combining knockout studies with protein localization techniques and interaction analyses using methods analogous to those applied for other S. pombe proteins.
For optimal sym1 expression in S. pombe, consider genomic library approaches similar to those used for other S. pombe proteins. The recommended method involves:
Creating genomic libraries using appropriate restriction enzymes (HindIII or Sau3AI partial digests have proven successful for other proteins)
Transforming into a relevant S. pombe strain
Screening transformants for the desired phenotype
Isolating plasmid DNA using established protocols like the "smash and grab" method
When designing expression vectors, the nmt1 promoter system is commonly used for protein overexpression in S. pombe, though this system may not allow precise determination of upper expression limits. For more controlled expression studies, consider genetic 'tug-of-war' (gTOW) vectors which provide measurable expression levels through selectable markers and GFP reporters .
To confirm successful expression of recombinant sym1 protein, implement a multi-step verification process:
| Verification Method | Technique Details | Expected Outcome |
|---|---|---|
| Molecular Detection | Western blot with specific antibodies | Protein band at expected molecular weight |
| Functional Analysis | Activity assays based on predicted function | Measurable biochemical activity |
| Localization | Fluorescence microscopy (if GFP-tagged) | Expected subcellular distribution |
| Mass Spectrometry | LC-MS/MS of purified protein | Peptide sequences matching sym1 |
The use of GFP-tagged vectors is particularly valuable, as they allow monitoring of expression levels via flow cytometry or fluorescence microscopy, similar to techniques used for other S. pombe proteins . For antibody generation, consider developing polyclonal antibodies against specific regions of sym1, as was successfully done for analyzing Sen1 protein in S. pombe .
Purification of recombinant sym1 from S. pombe should be approached systematically, drawing from successful purification strategies used for other S. pombe proteins. Based on established methods for polynucleotide-dependent ATPases in S. pombe , consider the following protocol:
Create large-scale S. pombe cultures expressing sym1 under appropriate induction conditions
Harvest cells at mid-log phase and prepare cell-free extracts using mechanical disruption
Implement a multi-step purification strategy:
Initial clarification by differential centrifugation
Ammonium sulfate precipitation (determine optimal percentage empirically)
Ion exchange chromatography (test both anion and cation exchange)
Affinity chromatography if specific interactions are known
Size exclusion chromatography as a final polishing step
Determine protein purity using SDS-PAGE and confirm identity by Western blotting or mass spectrometry. For difficult-to-express proteins, consider using fusion tags (His, GST, or MBP) with engineered protease cleavage sites. Monitor activity throughout purification to ensure the recombinant protein maintains its functional integrity.
Clone sym1 into gTOW vectors with different promoter strengths
Transform these constructs into appropriate S. pombe strains
Measure plasmid copy numbers using real-time PCR to quantify gene dosage
Correlate copy numbers with growth phenotypes to determine tolerance thresholds
Use flow cytometry to analyze GFP expression as a proxy for protein levels
This approach has successfully determined overexpression limits for numerous cell-cycle regulators in S. pombe. The data can be used to build mathematical models predicting cellular responses to different sym1 expression levels, similar to the integrative models developed for cell-cycle regulation .
To comprehensively identify sym1 binding partners, employ complementary approaches that address both direct and indirect interactions:
| Method | Application | Advantages | Limitations |
|---|---|---|---|
| Yeast Two-Hybrid | Screen for direct interactions | High-throughput capability | May miss context-dependent interactions |
| Co-immunoprecipitation | Verify interactions in vivo | Preserves native conditions | Requires specific antibodies |
| Proximity-based labeling (BioID) | Identify proximal proteins | Captures transient interactions | May identify non-specific interactions |
| Genetic interaction mapping | Functional relationships | Reveals pathway connections | Indirect evidence of physical interaction |
When designing these experiments, consider the approach used to study Yab8p-Yip1p interactions in S. pombe, which successfully demonstrated functional homology to SMN-SIP1 interactions in higher eukaryotes . For genetic studies, conditional knock-out strains can be particularly valuable for essential proteins, allowing controlled depletion of sym1 while monitoring effects on potential interaction partners.
When faced with conflicting data regarding sym1 function, implement a systematic analytical framework:
Evaluate methodological differences between studies:
Expression systems and promoter strength variations
Strain background genetic differences
Experimental conditions (temperature, media, stressors)
Detection methods and their sensitivity
Consider protein context factors:
Post-translational modifications affecting function
Subcellular localization differences
Presence of interacting partners
Protein stability and turnover rates
Analyze functional redundancy:
Resolution often requires integrating multiple lines of evidence rather than privileging a single experimental approach. Create a comprehensive model that accounts for conditional functionality, similar to how pyp1's regulatory roles in fbp1 transcription, sexual development, and mitosis were reconciled through careful pathway analysis .
Mathematical modeling of sym1's role should build upon established approaches for S. pombe cellular pathway analysis. Consider implementing:
Ordinary differential equation (ODE) models:
Develop rate equations for sym1 interactions
Incorporate known regulatory mechanisms
Optimize parameters through experimental data fitting
Test model robustness against overexpression data
Stochastic simulation algorithms:
Account for natural variation in protein levels
Model low-abundance interactions more accurately
Predict phenotypic variability in cell populations
Network-based approaches:
Integrate sym1 into existing pathway models
Identify network motifs and feedback loops
Predict system-level responses to perturbations
The approach used for modeling cell-cycle regulation in S. pombe provides an excellent template, where a basic model was refined to incorporate gTOW-derived overexpression limits . This integrated approach successfully predicted cellular phenotypes and gene function, demonstrating the power of combining mathematical modeling with experimental data for understanding protein function in complex cellular contexts.
Sym1 in S. pombe can serve as a powerful model system for studying homologous proteins in complex organisms by leveraging the experimental advantages of yeast while maintaining functional relevance. To establish this model:
Perform thorough sequence and structural analysis to identify conserved domains and motifs across species
Conduct complementation experiments by expressing human homologs in sym1-deficient S. pombe
Generate chimeric proteins combining domains from S. pombe sym1 and human counterparts to map functional regions
Create targeted mutations in conserved residues to establish structure-function relationships
This approach has been successfully demonstrated with Yab8p, which was shown to be functionally related to the human SMN protein involved in spinal muscular atrophy. The conservation of interaction modes between Yab8p-Yip1p and SMN-SIP1 provided valuable insights into protein function across species . Similarly, sym1 research could yield insights applicable to human disease mechanisms involving homologous proteins.
To investigate sym1's potential involvement in DNA damage response pathways, consider implementing a comprehensive experimental strategy inspired by studies of other S. pombe proteins in this context:
Generate conditional and null mutants of sym1 using CRISPR-Cas9 or traditional gene replacement
Evaluate sensitivity to DNA-damaging agents (UV, MMS, hydroxyurea, ionizing radiation) with survival assays
Examine genetic interactions with established DNA repair factors through double mutant analysis
Analyze recruitment to sites of damage using live-cell imaging with fluorescently tagged sym1
Implement ChIP-seq to identify potential DNA binding sites following damage induction
This approach should draw on methodologies used to study rrp1 and rrp2 proteins in S. pombe, which were found to function in the Srs2- and Swi5/Sfr1-dependent pathway in response to DNA damage . The resulting data would position sym1 within the broader context of cellular responses to genotoxic stress.
Integrating multi-omics approaches offers transformative potential for comprehensively understanding sym1 function:
Proteome-wide interaction mapping:
Systematic affinity purification-mass spectrometry (AP-MS)
Cross-linking mass spectrometry to capture transient interactions
Protein correlation profiling across cellular fractions
Genomic profiling under sym1 perturbation:
RNA-seq to identify transcriptional changes
ChIP-seq if DNA interactions are suspected
ATAC-seq to examine chromatin accessibility changes
Integrated data analysis:
Network construction combining protein-protein and genetic interactions
Pathway enrichment analysis across conditions
Machine learning approaches to identify patterns across datasets
This integrated approach would position sym1 within its complete functional context, similar to how comprehensive studies of cell cycle regulators in S. pombe have yielded systems-level understanding of regulatory networks . The resulting model would facilitate hypothesis generation for targeted functional studies and potentially reveal unexpected roles for sym1 in cellular processes.
When designing CRISPR-based strategies for sym1 manipulation, researchers should consider the following critical factors:
Guide RNA design:
Use S. pombe codon optimization for Cas9 expression
Select target sites with minimal off-target potential
Verify guide efficiency in silico before implementation
Consider multiple guides for difficult loci
Repair template design:
Include sufficiently long homology arms (500-1000bp)
Incorporate silent mutations in PAM sites to prevent re-cutting
Consider the impact of tags on protein function and localization
Include selectable markers for efficient screening
Experimental validation:
Confirm edits by sequencing
Verify protein expression/absence by Western blotting
Compare phenotypes with traditional gene deletion methods
Check for off-target effects in key pathways
Special considerations for essential genes:
Design conditional systems (e.g., auxin-inducible degrons)
Create partial loss-of-function alleles
Consider diploid-based approaches for initial manipulations
These strategies build upon established genetic manipulation techniques in S. pombe while leveraging cutting-edge genome editing technologies to achieve precise and controlled manipulation of sym1, facilitating detailed functional characterization in various cellular contexts.