Sbh1 is a tail-anchored protein with a single transmembrane domain and a cytosolic domain containing intrinsically unstructured regions . In Schizosaccharomyces pombe (fission yeast), it interacts with the Sec61 channel to regulate ER protein import. The recombinant form is produced heterologously for structural, functional, and biochemical studies.
ER Protein Translocation:
Guides suboptimal signal peptides (SPs) or transmembrane domains (TMDs) into the Sec61 lateral gate .
Phosphorylation-Dependent Regulation: Phosphorylation at N-terminal residues (e.g., S3/T5) induces conformational changes in the NUT region, enhancing substrate recognition . The phospho-S/T–specific proline isomerase Ess1 (PIN1 in mammals) facilitates this process .
Substrate Specificity:
Sbh1-dependent proteins exhibit:
Example substrates include enzymes critical for ER proteostasis and transmembrane proteins with polybasic regions .
Enhanced Protein Secretion: Overexpression of Sbh1 improves secretion efficiency in vacuolar sorting mutants (e.g., Δypt7), increasing extracellular protein yields up to fourfold .
ELISA-Based Detection: Recombinant Sbh1 is used in ELISA kits for quantifying endogenous Sbh1 levels in S. pombe lysates .
Peptide Panning: Revealed that the CMP domain binds Sbh1-dependent SPs, confirming its role as a "gatekeeper" for substrate entry .
Co-Immunoprecipitation: Demonstrated interactions with Sec61α, Sss1, and Rtn1, suggesting roles beyond translocation .
NUT Region Phosphorylation: Mutating S3/T5 to alanine mimics Δsbh1 temperature sensitivity, reducing ER import of Sbh1-dependent substrates .
Ess1 Dependency: ER import of Sbh1-dependent proteins requires Ess1-mediated isomerization of proline residues in the NUT region .
| Organism | Sequence Identity (%) | Essentiality |
|---|---|---|
| S. pombe | 58.6% (vs. S. cerevisiae) | Essential for viability |
| Yarrowia lipolytica | 68.8% (vs. S. cerevisiae) | Complements S. cerevisiae mutants |
KEGG: spo:SPBC2G2.03c
STRING: 4896.SPBC2G2.03c.1
S. pombe protein transport protein sec61 subunit beta (sbh1) is a 102-amino acid protein with the following sequence: MSSTKASGSVKNSAASAPGGPKSQIRRRAAVEKNTKESNSGPAGARAAGAPGSTPTLLKLYTDEASGFKVDPVVVMVLSVGFIASVFLLHIVARILKKFASE . This protein is encoded by the sbh1 gene (ORF name: SPBC2G2.03c) and has the UniProt accession number O43002 .
Structurally, sbh1 is a tail-anchored membrane protein with a single C-terminal transmembrane domain that anchors it to the Sec61 channel . The protein contains a cytosolic domain with two distinct regions: an N-terminal intrinsically unstructured domain (approximately the first 40 amino acids) followed by a conserved membrane proximal (CMP) domain . Unlike its S. cerevisiae counterpart, S. pombe sbh1 lacks proline-flanked phosphorylation sites in its N-terminal cytosolic domain .
In S. pombe, sbh1 functions as part of the Sec61 translocon pore complex alongside Sec61 and Sss1 proteins . While Sec61 forms the central protein-conducting channel with 10 transmembrane helices, sbh1 and Sss1 are single-spanning membrane proteins that associate peripherally with the complex . Sss1 is located at the channel periphery where it contacts both halves of Sec61 and holds them together .
Unlike S. cerevisiae and other post-whole genome duplication (WGD) species that have two homologs (Sbh1 and Sbh2), S. pombe has only a single sbh1 homolog . This means that in S. pombe, both the Sec61 and Ssh1 translocon pores share the same beta (sbh1) and gamma (Sss1) subunits, differing only in their alpha subunit (Sec61 or Ssh1) . This single sbh1 homolog is likely essential for viability in S. pombe, whereas neither Sbh1 nor Sbh2 alone is essential in S. cerevisiae .
For optimal stability and activity of recombinant S. pombe sbh1 protein:
Store the protein at -20°C for regular use, or at -20°C to -80°C for extended storage
Use a Tris-based buffer with 50% glycerol optimized for protein stability
Avoid repeated freezing and thawing cycles as this can lead to protein denaturation
For short-term experimental work, store working aliquots at 4°C for up to one week
When designing experiments, consider that recombinant sbh1 may contain a tag (the exact type is determined during the production process)
Methodologically, it's important to verify protein integrity by SDS-PAGE before experimental use, especially after storage periods or when transportation might have compromised protein quality.
Recent research has revealed that the CMP domain of sbh1 functions as a critical gatekeeper that recognizes and guides specific substrates toward the Sec61 channel for insertion . Peptide panning experiments have demonstrated that the sbh1 CMP domain contains specific binding sites for sbh1-dependent signal peptides, suggesting a role in substrate selection .
Molecular dynamics (MD) modeling has identified a potential interaction site between the sbh1 CMP domain and the Sec61 N-terminal amphipathic helix . The methodological approach involved:
Using MODELLER to model the Sec61 N-terminal amphipathic helix (sequence: 1MSSNRVLDLFKPFESFLPEVIAPE24) and the 36-aa N-terminal stretch of Sbh1 (sequence: 1MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSN36) into α-helical conformations
Integrating the N-terminus of Sec61p with the downstream TMD1 into a POPC lipid bilayer using CHARMM-GUI and the PPM server
Performing 300 ns long simulated tempering molecular dynamics simulations at 11 discrete temperatures (300-350K) to enhance conformational sampling
Extracting conformations with temperatures ≤303K and clustering them using a 2.5Å RMSD distance criterion
Testing three potential contacting conformations between the cytosolic N-termini of Sbh1 and Sec61p with varying angles between their helical axes (0°, +30°, or -30°)
Through site-directed mutagenesis, researchers have confirmed that the CMP region controls the import of sbh1-dependent translocation substrates into the ER . This suggests that sbh1 enhances the insertion efficiency of specific translocation substrates by guiding their signal peptides into the Sec61 channel via its CMP region .
Comparative sequence analysis of sbh1 proteins from different yeast species has revealed an interesting pattern: sbh1 proteins from several pathogenic yeast species contain one or more proline-flanked phosphorylation sites in their N-terminal cytosolic domains, whereas sbh1 from non-pathogenic yeast species (including S. pombe, K. lactis, Y. lipolytica, P. pastoris, and H. polymorpha) do not contain these sites .
This structural difference may have functional implications, particularly regarding the regulation of protein secretion and virulence factor export. In pathogenic fungi like C. neoformans, sbh1 controls the entry of virulence factors into the secretory pathway, thereby regulating fungal pathogenicity . The absence of these phosphorylation sites in S. pombe sbh1 suggests different regulatory mechanisms for protein translocation in non-pathogenic versus pathogenic yeasts.
For researchers, this distinction offers valuable experimental opportunities:
Comparative studies between S. pombe sbh1 and homologs from pathogenic species could reveal mechanisms of virulence regulation
Introducing proline-flanked phosphorylation sites into S. pombe sbh1 through site-directed mutagenesis could provide insights into their functional significance
Phosphoproteomic analyses across different growth conditions could reveal whether alternative phosphorylation mechanisms exist in S. pombe
Since S. pombe contains only a single sbh1 homolog that must function with both Sec61 and Ssh1 translocon complexes , investigating this dual functionality presents unique research opportunities. Here are methodological approaches for such investigations:
Protein-Protein Interaction Studies:
Co-immunoprecipitation (Co-IP) using antibodies against sbh1 to pull down associated proteins, followed by mass spectrometry to identify interactions with Sec61 versus Ssh1 complexes
Proximity labeling techniques such as BioID or APEX to identify proteins in close proximity to sbh1 in vivo
Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) to visualize interactions between sbh1 and components of either translocon complex
Functional Separation:
Utilize strains with temperature-sensitive mutations in either SEC61 or SSH1 to examine sbh1 function when one complex is compromised
Employ ribosome profiling to identify mRNAs preferentially translated at either Sec61 or Ssh1 complexes and examine how sbh1 depletion affects their translation
Create partially functional sbh1 mutants that preferentially interact with either Sec61 or Ssh1 to dissect complex-specific functions
Structural Biology Approaches:
Cryo-electron microscopy of purified Sec61 and Ssh1 complexes from S. pombe to determine if sbh1 adopts different conformations in each complex
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of sbh1 with differential solvent exposure when bound to different complexes
Studies have shown that phosphorylation of sbh1/Sec61β at specific residues (S3/T5) results in conformational changes in the intrinsically unstructured N-terminus . To investigate these changes in S. pombe sbh1, researchers can employ:
In Vitro Approaches:
Computational Methods:
Molecular dynamics simulations comparing the conformational ensemble of phosphorylated and non-phosphorylated sbh1
Machine learning approaches to predict phosphorylation-induced structural changes
Functional Studies:
Creation of phosphomimetic (S→D or S→E) and phosphodeficient (S→A) mutants to probe the functional consequences of phosphorylation
Quantitative proteomics to identify substrates whose translocation efficiency is affected by sbh1 phosphorylation state
Table: Recommended Experimental Approaches for Studying sbh1 Phosphorylation
When designing expression systems for recombinant S. pombe sbh1, researchers should consider several factors:
Expression Hosts:
E. coli: Suitable for high-yield expression of the cytosolic domain alone
Yeast systems (P. pastoris, S. cerevisiae): Preferred for full-length protein with proper membrane insertion
Insect cells (Sf9, High Five): Useful for obtaining higher eukaryotic post-translational modifications
Purification Strategies:
For full-length sbh1:
Solubilization with mild detergents (DDM, LMNG) to maintain native conformation
Affinity purification using N-terminal tags (His, GST, MBP) since the C-terminus is embedded in the membrane
Size exclusion chromatography in detergent micelles or reconstitution into nanodiscs or liposomes for functional studies
For the cytosolic domain alone:
Direct expression as a soluble protein with affinity tags
Ion exchange chromatography followed by size exclusion
Quality Control:
Verification of proper folding using circular dichroism spectroscopy
Mass spectrometry to confirm protein identity and detect post-translational modifications
Functional assays to verify activity (e.g., binding to Sec61 or signal peptides)
Based on recent findings that the sbh1 CMP domain contains binding sites for specific signal peptides , several methodological approaches can be employed to study these interactions:
Binding Assays:
Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to measure binding kinetics between immobilized sbh1 and various signal peptides
Microscale thermophoresis (MST) to detect interactions in solution with minimal protein consumption
Isothermal titration calorimetry (ITC) to obtain comprehensive thermodynamic parameters of binding
Structural Approaches:
X-ray crystallography of sbh1 CMP domain in complex with signal peptides
NMR spectroscopy to map binding interfaces and identify residues involved in signal peptide recognition
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions protected upon signal peptide binding
Computational Methods:
Molecular docking to predict binding modes between sbh1 CMP domain and signal peptides
Molecular dynamics simulations to study the dynamics of sbh1-signal peptide complexes
Machine learning approaches to predict signal peptide specificity based on sequence features
Functional Validation:
Site-directed mutagenesis of predicted binding residues followed by in vitro binding assays
In vivo translocation assays using reporter proteins with various signal sequences
Crosslinking studies to capture transient interactions during translocation
Unlike in S. cerevisiae where neither SBH1 nor SBH2 alone is essential, the single sbh1 homolog in S. pombe is likely essential for viability . To study this essentiality and its functional implications, researchers can use:
Genetic Approaches:
Construction of conditional mutants:
Temperature-sensitive alleles
Auxin-inducible degron (AID) system for controlled protein depletion
Tetracycline-regulatable promoter systems to modulate expression levels
Partial loss-of-function mutations:
Domain-specific deletions to separate essential from non-essential functions
Point mutations in conserved residues identified through sequence alignment
Complementation Studies:
Testing whether sbh1 homologs from other species can rescue S. pombe sbh1 mutants
Creating chimeric proteins with domains from different species to identify functionally critical regions
High-throughput Screens:
Synthetic genetic array (SGA) analysis to identify genes that become essential in sbh1 hypomorphic backgrounds
Chemical genetic screens to identify compounds that specifically target cells with compromised sbh1 function
Cellular Physiology:
Ribosome profiling to examine global translational changes upon sbh1 depletion
Proteomics analysis to identify proteins whose levels are most affected by sbh1 depletion
Electron microscopy to examine changes in ER morphology and translocation capacity
Molecular dynamics (MD) simulations have already provided valuable insights into sbh1 interactions with the Sec61 channel . Researchers can expand on these approaches with:
Advanced Simulation Protocols:
Enhanced sampling techniques:
Replica exchange MD to overcome energy barriers and explore conformational space more efficiently
Metadynamics to calculate free energy landscapes of sbh1 conformational changes
Steered MD to study force-dependent processes during translocation
Multi-scale modeling:
Coarse-grained simulations to study large-scale movements of the translocon complex
Quantum mechanics/molecular mechanics (QM/MM) for detailed studies of specific interactions
Specific Applications:
Simulating conformational changes induced by phosphorylation at specific residues
Modeling the dynamics of signal peptide recognition and binding by the CMP domain
Investigating how sbh1 interacts with both Sec61 and Ssh1 complexes
Exploring the dynamics of sbh1 during different stages of the translocation process
The methodology demonstrated in the literature provides a solid foundation, utilizing:
MODELLER for initial structure prediction
CHARMM36m force field with TIP3P water
Simulated tempering across multiple temperatures (300-350K)
Clustering analysis with 2.5Å RMSD criteria
Several cutting-edge technologies show promise for advancing our understanding of sbh1 function:
CryoET and Subtomogram Averaging:
This approach allows visualization of the translocon complex in its native membrane environment, potentially revealing how sbh1 functions in different substrate-specific contexts.
Time-Resolved Structural Methods:
Time-resolved cryo-EM to capture different states of the translocation process
Time-resolved FRET to monitor conformational changes during translocation
Single-molecule techniques to observe individual translocation events
Genome Engineering:
CRISPR-Cas9 for precise genomic modifications of sbh1 and interacting partners
Base editing for introducing specific mutations without double-strand breaks
Prime editing for precise insertions and deletions
Advanced Imaging:
Super-resolution microscopy (STORM, PALM) to visualize sbh1 distribution and dynamics at the ER membrane
Expansion microscopy to physically enlarge samples for improved resolution
Correlative light and electron microscopy (CLEM) to combine functional and structural information
Proteomic Approaches:
Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling to map the dynamic interactome of sbh1
Crosslinking mass spectrometry (XL-MS) to capture transient interactions during translocation
Targeted protein degradation (TPD) approaches to study acute loss of sbh1 function
The unique evolutionary position of S. pombe as a pre-WGD organism with a single sbh1 homolog makes comparative studies particularly valuable:
Sequence Conservation Analysis:
S. pombe Sec61p shares 58.6% sequence identity with S. cerevisiae Sec61p . This moderate conservation suggests both shared and species-specific functions. Notably, S. pombe sbh1 lacks the proline-flanked phosphorylation sites found in pathogenic yeast species , suggesting different regulatory mechanisms.
Functional Complementation:
While Y. lipolytica SEC61 can complement a null mutation in S. cerevisiae, the S. pombe homolog failed to complement the respective mutant in S. cerevisiae . This failure was attributed to non-conserved amino acid substitutions within the cytoplasmic loop between transmembrane helices 4 and 5 , highlighting the importance of cytosolic interactions for Sec61 function.
Phylogenetic Classification:
Interestingly, sequence alignment shows that S. pombe Ssh1 does not align with the Ssh1 protein cluster from other species but rather with the Sec61 cluster . This raises important questions about functional complementation and evolutionary divergence.
Experimental Approaches for Comparative Studies:
Heterologous expression of sbh1 from different species in S. pombe sbh1 conditional mutants
Domain swapping experiments to identify regions responsible for species-specific functions
Comparative interactome analysis to identify conserved and divergent binding partners
The presence of a single sbh1 in S. pombe versus the duplicated SBH1/SBH2 in post-WGD species like S. cerevisiae provides an excellent model for studying protein evolution after gene duplication:
Functional Specialization vs. Redundancy:
In S. cerevisiae, Sbh1 primarily associates with the Sec61 complex while Sbh2 associates with the Ssh1 complex . In contrast, S. pombe must use its single sbh1 for both complexes . This suggests potential functional constraints on the S. pombe protein that may have been relieved by gene duplication in S. cerevisiae.
Methodological Approaches:
Replace S. cerevisiae SBH1 and SBH2 with S. pombe sbh1 to test functional complementation
Create chimeric proteins combining domains from S. pombe sbh1 with S. cerevisiae Sbh1/Sbh2
Compare the interactomes of S. pombe sbh1 with those of S. cerevisiae Sbh1 and Sbh2
Analyze the effects of mutations in conserved residues across different species
Evolutionary Insights: Studying how S. pombe sbh1 functions with both translocon complexes can provide insights into the ancestral state before gene duplication and subsequent specialization in post-WGD species.