Recombinant Schizosaccharomyces pombe Protein transport protein sft2 (sft2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sft2

Recombinant Sft2 is derived from the fission yeast Schizosaccharomyces pombe (strain 972/ATCC 24843). It is classified as a protein transport protein involved in intracellular trafficking processes. The recombinant version is produced in E. coli with a His tag for purification and detection purposes .

Key Identifiers:

  • UniProt ID: Q9P6K1

  • Gene Name: sft2

  • ORF Designation: SPAC1527.02

Table 1: Sequence Features

FeatureDetails
Amino Acid SequenceMEGSFQSRLQSIIQRTGETTAESTNSWYNRLRTSMPWSNDYTEIPTNASGGNSYFQSSEFSLSRWERYmLFGICLLGSLACYAIACFMFPVLVLKPRKFVLLWTMGSLLAVLGFAIVQGFVAHFRQLTTMERLPITLSYFVTLLATIIATIKIKSTILSIVFGVLHILSFVAYLIAFFPFGTRTVSLGTRMASRSLSNWLP
DomainsPredicted transmembrane regions consistent with vesicle transport proteins.
Post-Translational ModificationsNone reported in current datasets.

Production and Purification

The recombinant protein is synthesized in E. coli and purified using affinity chromatography.

Future Directions

Further research is needed to:

  1. Elucidate Sft2’s specific role in S. pombe membrane trafficking.

  2. Characterize its interaction partners using pulldown assays or yeast two-hybrid screens.

  3. Validate structural predictions via cryo-EM or X-ray crystallography.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your formulation.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
sft2; SPAC1527.02; Protein transport protein sft2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
sft2
Target Protein Sequence
MEGSFQSRLQSIIQRTGETTAESTNSWYNRLRTSMPWSNDYTEIPTNASGGNSYFQSSEF SLSRWERYMLFGICLLGSLACYAIACFMFPVLVLKPRKFVLLWTMGSLLAVLGFAIVQGF VAHFRQLTTMERLPITLSYFVTLLATIIATIKIKSTILSIVFGVLHILSFVAYLIAFFPF GTRTVSLGTRMASRSLSNWLP
Uniprot No.

Target Background

Function
Sft2 is a nonessential protein involved in the fusion of transport vesicles derived from the endocytic pathway with the Golgi complex. It can be functionally replaced by got1.
Database Links
Protein Families
SFT2 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How does Sft2 relate to other membrane trafficking proteins in S. pombe?

S. pombe contains several Golgi transport-related proteins that work in concert with Sft2, including Sft1 and Gos1. These proteins are part of the membrane trafficking network that maintains proper Golgi function. Research has shown that these Golgi transport proteins, along with other membrane components like the UDP-galactose transporter Gms1, function together to ensure proper cell wall organization and biogenesis . Proteins in this functional category are often studied together to understand their collective roles in maintaining cellular integrity and proper trafficking of biomolecules through the secretory pathway.

What are the common methods for studying Sft2 function in S. pombe?

Several approaches can be used to study Sft2 function:

  • Gene deletion studies: Creating Δsft2 strains to observe phenotypic effects

  • Localization studies: Using fluorescent protein fusions to track Sft2 subcellular localization

  • Protein-protein interaction studies: Employing yeast two-hybrid or co-immunoprecipitation techniques

  • Functional complementation: Testing whether wild-type sft2+ can rescue phenotypes in deletion mutants

For gene deletion studies, PCR-based targeted gene deletion methods are commonly employed in S. pombe, using markers like ura4+ in strains with genetic backgrounds such as h+ leu1-32 ura4-D18 ade6-M210 or -M216 . Growth phenotypes can then be assessed using streak assays or microtiter assays under various conditions to determine the impact of Sft2 absence.

How can researchers optimize the expression and purification of recombinant S. pombe Sft2 protein?

For optimal expression and purification of recombinant S. pombe Sft2 protein:

  • Expression system selection: While E. coli is commonly used, membrane proteins like Sft2 may benefit from expression in eukaryotic systems (yeast, insect cells) that provide proper post-translational modifications

  • Solubilization strategy: As a membrane protein, Sft2 requires appropriate detergents for extraction from membranes

  • Tag selection: Consider using a His-tag for IMAC purification or other affinity tags that maintain protein function

  • Storage conditions: Recombinant Sft2 is typically stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

  • Avoiding degradation: Working aliquots should be kept at 4°C for up to one week, with repeated freeze-thaw cycles avoided

When expressing the full-length protein (amino acids 1-201), researchers should be mindful of the hydrophobic transmembrane regions that may affect solubility and proper folding.

What phenotypes are associated with sft2 deletion or dysfunction in S. pombe?

While specific phenotypes for Δsft2 strains aren't detailed in the provided search results, inferences can be made based on related Golgi transport proteins in S. pombe. Disruption of Golgi trafficking proteins often leads to:

  • Cell wall integrity defects: As seen with other Golgi transport mutants, Δsft2 may show hypersensitivity to cell wall-targeting drugs like micafungin

  • Morphological abnormalities: Possible changes in cell shape or size due to compromised secretory function

  • Altered response to antifungal compounds: Like other membrane trafficking mutants, Δsft2 may show altered sensitivity to ergosterol biosynthesis inhibitors

  • Glycosylation defects: Impaired protein modification leading to functional protein deficiencies

Studies in S. pombe typically assess these phenotypes through drug sensitivity assays, microscopic evaluation of cell morphology, and biochemical analysis of secreted or cell wall components.

How does Sft2 function in the context of the broader S. pombe membrane trafficking network?

The membrane trafficking network in S. pombe involves multiple interconnected pathways. Sft2 functions within this complex system alongside proteins like:

ProteinFunctionRelationship to Sft2
Gos1SNARE proteinWorks in parallel Golgi transport pathways
Sft1Related Golgi transport proteinMay have overlapping or complementary functions
Vps45Vacuolar protein sortingOperates in a connected trafficking pathway; deletion causes drug sensitivity
Gga1Membrane traffickingMay interact with Sft2-mediated pathways; deletion causes terbinafine sensitivity

The full functional context of Sft2 likely involves:

  • Vesicle formation at the Golgi

  • Proper sorting of cargo proteins

  • Maintenance of Golgi structure

  • Communication with other cellular compartments

Understanding these relationships requires comprehensive approaches combining genetic interactions, protein localization studies, and functional assays.

What techniques can be used to study protein-protein interactions involving Sft2 in S. pombe?

Several techniques can be employed to study Sft2 interactions:

  • Proximity-based mass spectrometry: Similar to methods used to identify Rtf2 protein interactions in S. pombe

  • Yeast two-hybrid screening: Can identify direct physical interactions with Sft2

  • Co-immunoprecipitation: Using tagged versions of Sft2 to pull down interaction partners

  • Genetic interaction screening: Identifying synthetic lethality or rescue between sft2 and other gene deletions

  • Fluorescence microscopy: Observing co-localization with potential interaction partners

When designing such experiments, it's important to consider that membrane proteins like Sft2 may require special conditions for maintaining native interactions. For example, the RING-finger motif found in some S. pombe proteins like Rtf2 can mediate protein-protein interactions , and similar structural motifs in Sft2 could be relevant for its interaction network.

How can researchers investigate the role of Sft2 in cell wall organization and biogenesis?

To investigate Sft2's role in cell wall organization:

  • Cell wall integrity assays: Test Δsft2 mutants for sensitivity to cell wall-disrupting agents like micafungin

  • Microscopic analysis: Examine cell wall thickness and morphology using electron microscopy

  • Biochemical composition analysis: Measure β-glucan, chitin, and mannoproteins in cell walls of wild-type versus Δsft2 strains

  • Genetic interaction studies: Create double mutants with known cell wall genes to identify functional relationships

  • Complementation experiments: Express Sft2 under authentic or nmt1 promoter in a multicopy vector to test rescue of phenotypes

Researchers should follow protocols similar to those used for other S. pombe membrane trafficking mutants, where transformants are grown to saturation in selective medium and serial dilutions are spotted onto test plates and incubated at 27°C for 4 days .

What are the evolutionary relationships between S. pombe Sft2 and similar proteins in other organisms?

Sft2 belongs to a family of conserved Golgi transport proteins found across eukaryotes. Evolutionary analysis could include:

  • Sequence alignment: Compare S. pombe Sft2 with homologs from S. cerevisiae, humans, and other model organisms

  • Phylogenetic tree construction: Determine evolutionary relationships and conservation

  • Domain analysis: Identify conserved functional motifs versus species-specific regions

  • Functional complementation: Test whether Sft2 homologs from other species can rescue the S. pombe Δsft2 phenotype

Unlike some S. pombe proteins that are not evolutionarily conserved beyond specific domains (such as the Myb-like DNA binding domain in Rtf1), Golgi transport proteins like Sft2 often have conserved functional domains across species , making them valuable for comparative studies.

How might researchers investigate potential connections between Sft2 and mRNA processing in S. pombe?

While direct connections between Sft2 and mRNA processing are not established in the provided search results, recent studies have revealed unexpected connections between seemingly unrelated cellular processes in S. pombe. For example, Rtf2, initially studied for DNA replication functions, was found to associate with mRNA processing and splicing factors .

To investigate potential Sft2 connections to mRNA processing:

  • RNA-seq analysis: Compare transcriptomes of wild-type and Δsft2 strains to identify potential splicing defects

  • Protein co-purification: Use tagged Sft2 to identify potential RNA-processing protein interactions

  • Genetic interaction screens: Test interactions between sft2 and genes involved in RNA processing

  • Functional rescue experiments: Determine if aberrant RNA processing in other mutants affects Sft2 function

Any unexpected connections would require validation through multiple independent techniques, similar to how the connection between Rtf2 and mRNA splicing was established through both physical association and functional studies .

What specialized techniques are required for studying membrane proteins like Sft2 in S. pombe?

Studying membrane proteins like Sft2 requires specialized approaches:

  • Membrane protein extraction: Using appropriate detergents to solubilize without denaturing

  • Membrane fractionation: Separating different cellular membranes to localize Sft2 precisely

  • Topology determination: Identifying which portions of Sft2 face the cytosol versus the lumen

  • In vivo imaging: Using specialized tags that don't disrupt membrane integration

  • Functional assays: Measuring transport activities that reflect Sft2's native function

When working with recombinant Sft2, researchers should be aware that the protein contains multiple hydrophobic regions that likely form transmembrane domains. The storage buffer with 50% glycerol is optimized for this particular protein's stability .

How can researchers design experiments to study Sft2's role in response to cell stress?

To investigate Sft2's potential role in stress response:

  • Stress condition panels: Expose Δsft2 and wild-type cells to various stressors (temperature shifts, osmotic stress, DNA damage, oxidative stress)

  • Drug sensitivity assays: Test sensitivity to antifungal agents using methods like:

    • Streak assays: Monitoring growth on plates with various concentrations of stress agents

    • Microtiter assays: Following CLSI guidelines with modifications for S. pombe

  • Protein localization changes: Monitor Sft2 localization under stress using GFP-tagged constructs

  • Transcriptional responses: Measure stress-responsive gene expression in Δsft2 versus wild-type cells

When analyzing drug sensitivity, researchers should score sensitivity relative to untreated controls using established categories: strongly sensitive (+++), moderately sensitive (++), or mildly sensitive (+) , with appropriate controls to ensure that phenotypes specifically result from the drug treatment.

What are the recommended controls and validation steps when working with recombinant S. pombe Sft2?

When working with recombinant Sft2:

  • Expression validation: Confirm proper expression using Western blotting with appropriate antibodies

  • Functional validation:

    • Complementation assays testing whether the recombinant protein rescues Δsft2 phenotypes

    • Activity assays specific to Sft2's transport function

  • Purity assessment: SDS-PAGE and mass spectrometry to confirm protein identity and purity

  • Stability testing: Verify proper folding using circular dichroism or limited proteolysis

  • Negative controls: Include mock purifications from expression systems without the Sft2 construct

Researchers should avoid repeated freeze-thaw cycles, as noted in product guidelines, and should store working aliquots at 4°C for no more than one week .

How can S. pombe Sft2 research contribute to understanding human Golgi transport mechanisms?

S. pombe serves as an excellent model for studying processes conserved in humans:

  • Conserved pathways: Many Golgi transport mechanisms are evolutionarily conserved from yeast to humans

  • Disease relevance: Dysfunction in Golgi transport proteins is linked to human diseases including glycosylation disorders and neurodegeneration

  • Experimental advantages:

    • S. pombe's genetic tractability allows for rapid testing of hypotheses

    • Haploid state simplifies genetic manipulation

    • Well-established assay systems for membrane trafficking

While S. pombe-specific proteins like Rtf1 may not be conserved beyond specific domains, many membrane trafficking proteins like Sft2 have functional homologs in human cells , making findings in fission yeast potentially translatable to human biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.