Recombinant Schizosaccharomyces pombe Protein transport protein yip1 (yip1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Yip1 is an evolutionarily conserved integral membrane protein involved in ER-to-Golgi trafficking. In Schizosaccharomyces pombe (fission yeast), it interacts with transport GTPases (e.g., Ypt1p, Ypt31p) and forms a complex with Yif1p, a related transmembrane protein . This complex is essential for vesicle docking and fusion, as demonstrated in Saccharomyces cerevisiae, where loss of Yip1 function disrupts secretory pathways and causes ER membrane proliferation .

GTPase Interaction and Vesicle Transport

Yip1 binds GDP-bound Ypt GTPases (Ypt1p, Ypt31p) via its cytosolic domain, facilitating vesicle docking . In S. cerevisiae, conditional yip1 mutants accumulate ER membranes and 40–50 nm vesicles, indicating a block in ER-to-Golgi transport .

Genetic Interactions

  • Synthetic lethality occurs between yip1 and yif1 mutants, confirming their functional interdependence .

  • Overexpression of Yif1p suppresses yip1 mutant defects, suggesting Yip1 acts upstream of Yif1p in the transport pathway .

Morphological Defects

  • Temperature-sensitive yip1 mutants exhibit ER membrane proliferation and secretory defects analogous to sec18 mutants (ER-to-Golgi block) .

Applications in Research

  • ELISA and binding assays: Used to study Yip1 interactions with GTPases or partner proteins .

  • Functional complementation: Recombinant Yip1 can rescue transport defects in yeast mutants .

  • Structural studies: The His-tagged protein enables biochemical characterization of membrane protein complexes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yip1; SPCC61.04c; Protein transport protein yip1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
yip1
Target Protein Sequence
MAYYNNPANLQYYDYSYTADNSFNTQSRAAGFYDEPLHEPLSQGWLAAFSTSGYPGEPSL LEELEINFGHIKQKTTHVLNPFKHVDVHIMDDTDMAGPILFCLLFSTFLSLHGRSHFGYI YGIALLGSLSLHFVLRLMSAKNLFFTRTVSVLGYSLLPLVVIAFFKNIFTFNGIAGYALA ALACIWCTYAASAMFVGILQVNNMRFLVAYPIALFYGVFAVITVFSK
Uniprot No.

Target Background

Function
Yip1 is essential for the fusion of ER-derived vesicles with the Golgi apparatus during ER-to-Golgi protein transport. It likely achieves this by mediating the correct membrane localization of ypt1.
Database Links
Protein Families
YIP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.