Recombinant Schizosaccharomyces pombe Protein YIP4 (SPAC644.13c)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Expression

SPAC644.13c is annotated in the S. pombe genome, though its functional role remains uncharacterized in the reviewed literature. Key observations include:

  • Expression Profiling: SPAC644.13c is not highlighted in mRNA expression datasets from vegetatively growing cells , suggesting low expression under standard conditions.

  • Chromatin Interactions: Proteins encoded by neighboring loci (e.g., transcription factors like Atf1, Rst2) are enriched in highly occupied target (HOT) regions , which may imply indirect regulatory roles for adjacent genes.

Protein Interaction Networks

While YIP4 itself is not discussed, systematic interaction studies in S. pombe provide frameworks for hypothesizing its function:

  • TF-Protein Interactions: Approximately 50% of S. pombe transcription factors (TFs) exhibit physical interactions with co-activators, chromatin remodelers, or metabolic enzymes . Proteins lacking DNA-binding domains (like YIP4) often partner with TFs to modulate activity.

  • 14-3-3 Protein Interactions: Many TFs and regulatory proteins bind 14-3-3 phospho-binding proteins , a conserved mechanism for post-translational regulation.

Comparative Proteomics and Secretion

Studies on recombinant protein production in S. pombe highlight challenges and strategies relevant to expressing proteins like YIP4:

Table 1: Key Factors Affecting Recombinant Protein Secretion in S. pombe

FactorImpact on SecretionExample from Literature
Promoter StrengthConstitutive promoters (e.g., nmt1) enhance yield Maltase secretion increased via nmt1
Membrane CompositionAltered lipid metabolism improves secretion efficiency Ergosterol supplementation
Amino Acid AvailabilityLimitation reduces tRNA pools, hindering synthesis Glutamate supplementation

Technical Insights for Recombinant YIP4 Production

Based on methodologies in the reviewed studies:

  • Strain Engineering: Endogenous tagging (e.g., epitope tags) enables precise immunoprecipitation and mass spectrometry (IP-MS) analysis .

  • Chromatin Profiling: ChIP-seq could map YIP4’s genomic targets if it associates with DNA-binding partners .

  • Proteogenomics: Integrating MS/MS data with six-frame genome translations identifies novel peptides and corrects gene models , a strategy applicable to characterizing YIP4.

Unresolved Questions and Future Directions

  • Functional Annotation: SPAC644.13c lacks Pfam domains or homology to characterized proteins, necessitating de novo functional studies.

  • Interaction Partners: IP-MS screens using tagged YIP4 could identify binding partners (e.g., TFs, metabolic enzymes) .

  • Subcellular Localization: Fluorescent tagging may clarify whether YIP4 localizes to membranes, nuclei, or stress granules.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific requirements. If so, please indicate your preference when placing the order, and we will prepare your product accordingly.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of that specified tag.
Synonyms
SPAC644.13c; Protein YIP4; YPT-interacting protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC644.13c
Target Protein Sequence
MTDIGKHNTEIEQDEMENLLRMDPVRSSLDVESRAIEPDNIAGESIVETRFTGGDSLDEP IRVTLFNEFRAIGEKLVYVLYPKNAQVLRDWDLWGPLIFSLVIALALALSTDKIERESVF TVVVALIWFGEAVCSLNIKLLGANISIFQSMCILGYSSFPLMIASIVCAFVPLIFIRIPV IVAMYAWTLFAAMGVLQNSNLSNKKLLAVYPLFLFYFSLAWIIFL
Uniprot No.

Target Background

Function
May be involved in proper membrane localization of Rab GTPases.
Database Links
Protein Families
YIP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.