Recombinant Schizosaccharomyces pombe Putative arrestin-related trafficking adapter C839.02 (SPBC839.02)

Shipped with Ice Packs
In Stock

Description

General Information

Schizosaccharomyces pombe Putative Arrestin-Related Trafficking Adapter SPBC839.02 is a protein that is a translation product of the SPBC839.02 gene in Schizosaccharomyces pombe 972h- . It is also referred to as a putative arrestin-related trafficking adapter SPBC839.02 (Schizosaccharomyces pombe 972h-) . The UniProt accession number for this protein is Q8WZK5 .

Table 1: Protein Information

UniProt AC / UniProt IDQ8WZK5 / ALY1_SCHPO
Protein NamePutative arrestin-related trafficking adapter SPBC839.02
Gene NameName: ORFNames:SPBC839.02;
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
PRO IDPR:Q8WZK5
PRO Nameputative arrestin-related trafficking adapter SPBC839.02 (Schizosaccharomyces pombe 972h-)
DefinitionA protein that is a translation product of the SPBC839.02 gene in Schizosaccharomyces pombe 972h-.
Short LabelSpom972h-SPBC839.02
Categoryorganism-gene

Homology and Function

SPBC839.02 is homologous to ART1, an arrestin-related trafficking adaptor (ART) in Saccharomyces cerevisiae . In S. pombe, a homolog of ART1 is Arn1, which is also known as Any1 . Arn1 contains a conserved arrestin motif, a ubiquitination site, and two PY motifs .

Arn1 contributes to amino acid uptake by regulating Cat1 endocytosis, in which Tsc2 is involved . Arn1 functions downstream of Tsc2 in amino acid uptake . The TSC molecules are conserved between fission yeast and mammals, whereas there are no counterparts of TSCs in S. cerevisiae .

Involvement in Amino Acid Uptake

Arn1 regulates endocytosis of the Cat1 amino acid transporter . Deletion of arn1+ suppresses a defect of amino acid uptake and the aberrant Cat1 localization in tsc2Δ . The internalized Cat1 in tsc2Δ causes resistance to canavanine . Restoration of Cat1 localization in tsc2Δ by deletion of arn1+ abolishes canavanine resistance .

Post-translational Modifications

SPBC839.02 is subject to post-translational modifications, including ubiquitination and phosphorylation .

Table 2: Post-Translational Modifications

SitePTM TypePTM EnzymeSource
K47UbiquitinationPomBase
S124PhosphorylationPomBase
K233UbiquitinationPomBase
K345UbiquitinationPomBase
S468PhosphorylationPomBase
S471PhosphorylationPomBase

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPBC839.02; Putative arrestin-related trafficking adapter SPBC839.02
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-530
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC839.02
Target Protein Sequence
MYIPNLRNYHDKVFPYGPSSNGYNPVIRLTDRTTQPDPSQHIYQEEKISKCEGLSYRARE WLLLSSNSNARVAIALAEPVLYLPGATSSEIQSEHSAVLRGSLCIQIYKPVKLKKIQLSF KGKSRTEWPEGIPPKLFDTYEENSIMNHCWVFFHSEQKVDENSHGAVWYKVLPHYADTAH YPRSMECFYPGEYVYNFELPISCTYPESIQTDMGRVYYFLETLVDRSSTFSGKSTGRIPI ELIRSPCSTSVATSEPILVSKSWEDRLHYEVQVGEKCVVMGQVVPVNFKFTLLGEVKFHK LRLFLMERRYYYCRQRSVRRKEKTRQLLLYERSAPKNQCLLSDWKQVRPDVYELSDQVRI PGCHDMAANIVHFDTTYPNIKITHTVRTVLRFSCENSPELMGSAKYLEIYIDSPVRLLSC RCSDGSTMLPAYCPIIPSSEVNFCSIDNRIIAGMNRDLALDSDIIGNSPPSFDSWTAVPY QAPPPKYDDIFQSGSSHDENHDDNYFINIFIIFLIIKHMCLITKMFLGLN
Uniprot No.

Target Background

Function
May regulate endocytosis in response to extracellular stimuli.
Database Links
Protein Families
ALY1 family

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.