Recombinant Schizosaccharomyces pombe Putative elongation of fatty acids protein 2 (SPAC1639.01c, SPAC806.09c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference for your preparations.
Shelf Life
The shelf life of our proteins is influenced by factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquot the protein to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag according to your needs.
Synonyms
SPAC1639.01c; SPAC806.09c; Putative elongation of fatty acids protein 2; 3-keto acyl-CoA synthase SPAC1639.01c; Very-long-chain 3-oxoacyl-CoA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC1639.01c
Target Protein Sequence
MPDSPTLHHNHIIGLENGSLTSNNNHQGMASVSVGQFQYPIWSWLNSLADATFGKRPSSF EFIVNKTRFSSAPVVATIIISYYLLILVGGRIMRNRQPIRLQKIFQYYNLTFSIASAILA LLIFEQVAPAIYKHGFFFSICNEKAWTQPLVFLYYCAYISKFLELTDTFFLVLRKKPLQF LHCYHHGATAVLVYTQIVGRTSISWLIIEINLLVHVTMYYYYYLVAKGIRVPWKKWVTRF QIVQFFADLGFIYFAVYTEVAYRLKFYKACMGHCSGHPLAAFCGLATISSYLVLFIVFYH NTYKKNAALKMKAKAAAATKGNSSESSKNADLKRLSKSNASIAEVKCNNIVTNLYPISSG LNNEK
Uniprot No.

Target Background

Function
This protein may be involved in the synthesis of very long chain fatty acids.
Database Links
Protein Families
ELO family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Putative elongation of fatty acids protein 2?

The putative elongation of fatty acids protein 2 (SPAC1639.01c, SPAC806.09c) is a protein encoded in the fission yeast S. pombe genome with a predicted role in fatty acid metabolism. According to sequence analysis, it is classified as a 3-keto acyl-CoA synthase (EC= 2.3.1.n8) that likely participates in long-chain fatty acid elongation . The protein contains 365 amino acids and has a Uniprot accession number Q7LKX0 . The amino acid sequence includes several hydrophobic regions consistent with a membrane-associated protein, which aligns with its predicted function in fatty acid metabolism that typically occurs in the endoplasmic reticulum .

Why is S. pombe an effective model organism for studying fatty acid metabolism proteins?

S. pombe represents an excellent model for studying conserved cellular processes including lipid metabolism due to several key advantages. First, S. pombe shares greater similarity with mammalian cells in many fundamental cellular processes compared to the more distantly related budding yeast S. cerevisiae . The organism offers sophisticated genetic manipulation tools, a well-characterized genome, and cellular machinery that often resembles human counterparts more closely than S. cerevisiae does . Additionally, S. pombe's three chromosomes and simplified genetic architecture facilitate genetic analyses . These features make S. pombe particularly valuable for studying fatty acid metabolism proteins that may have functional homologs in higher eukaryotes including humans.

What expression systems are optimal for producing functional recombinant SPAC1639.01c protein?

For expression of functional recombinant SPAC1639.01c protein, researchers should consider multiple expression systems, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay lack proper post-translational modifications, potential issues with membrane protein folding
S. cerevisiaeEukaryotic system, better folding of membrane proteinsLower yield than E. coli, longer expression time
Insect cellsAdvanced eukaryotic system, good for membrane proteinsMore expensive, technically demanding
Mammalian cellsClosest to native human conditionsHighest cost, lowest yield, most complex protocol

For initial characterization, expressing the protein in its native host S. pombe with appropriate epitope tags (HA or FLAG) would be advantageous for immunoprecipitation studies . For biochemical studies requiring larger quantities, an optimized E. coli system with membrane protein-specific modifications such as specialized strains (C41/C43) or fusion partners (MBP, SUMO) may be necessary. The recombinant protein should be stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

How can researchers design effective assays to measure fatty acid elongation activity?

Designing effective assays to measure the fatty acid elongation activity of SPAC1639.01c requires multiple complementary approaches:

  • Radiolabeled substrate incorporation assay: Use 14C-malonyl-CoA or 14C-labeled acyl-CoA substrates to measure the incorporation into longer chain fatty acids, followed by lipid extraction and thin-layer chromatography or HPLC analysis.

  • Mass spectrometry-based assays: Employ targeted lipidomics to measure changes in fatty acid and lipid profiles when the protein is manipulated. This approach can track 13C-labeled fatty acid precursors to precisely determine elongation activity, similar to methods used for AdipoR2 studies .

  • In vitro reconstitution: Purify the recombinant protein and reconstitute it with other known components of the elongation machinery in liposomes or nanodiscs to measure activity in a controlled environment.

  • Genetic complementation: Test whether the S. pombe gene can rescue phenotypes in mutant strains of other organisms with defects in fatty acid elongation.

When designing these assays, researchers should include appropriate controls including substrate specificity tests, time-course analyses, and comparison with known elongase enzymes to validate results.

What approaches are most effective for studying SPAC1639.01c protein interactions?

To effectively study protein interactions involving SPAC1639.01c, researchers should employ multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP): Using epitope-tagged versions of SPAC1639.01c (HA or FLAG tags), perform Co-IP from native chromatin or membrane preparations followed by mass spectrometry analysis to identify interacting partners, as demonstrated in studies with other S. pombe proteins .

  • Yeast two-hybrid screening: While this has limitations for membrane proteins, modified membrane yeast two-hybrid systems can be employed to detect interactions.

  • Proximity labeling techniques: BioID or APEX2 fusion proteins can identify proximal proteins in the native cellular environment, which is particularly valuable for membrane proteins.

  • Crosslinking mass spectrometry: This can capture transient or weak interactions and provide structural information about the interaction interface.

  • Fluorescence techniques: FRET, FLIM, or BiFC can be used to validate specific interactions in live cells.

Recent research with adiponectin receptors demonstrates that proteins involved in fatty acid metabolism often form functional complexes with other enzymes in the pathway . Investigations of SPAC1639.01c should therefore focus on potential interactions with dehydratases like HACD3 and fatty acid activation enzymes similar to ACSL4, which have been shown to interact with related fatty acid processing proteins .

How does SPAC1639.01c function compare with mammalian fatty acid elongation systems?

The putative elongation of fatty acids protein 2 (SPAC1639.01c) in S. pombe likely functions as part of a conserved fatty acid elongation system that shares fundamental similarities with mammalian systems while exhibiting species-specific differences. Based on sequence analysis and predicted function, this protein appears to be involved in the condensation step of fatty acid elongation .

In mammalian systems, fatty acid elongation occurs through a four-step cycle (condensation, reduction, dehydration, and reduction) performed by distinct enzymes including ELOVL family proteins, which are condensing enzymes analogous to the putative function of SPAC1639.01c. Research on AdipoR2 reveals that fatty acid elongation systems often involve protein complexes that include dehydratases like HACD3 and acyl-CoA synthetases like ACSL4 that activate fatty acids for incorporation into phospholipids .

Researchers should investigate whether SPAC1639.01c forms similar complexes with S. pombe homologs of these proteins. Comparative studies using complementation assays, where the S. pombe gene is expressed in mammalian cells with knockdown of corresponding ELOVLs, would determine functional conservation across species. Additionally, lipidomic analysis comparing the fatty acid profiles affected by SPAC1639.01c manipulation to those affected by mammalian ELOVL alterations would provide valuable insights into functional similarities and differences.

What role might SPAC1639.01c play in membrane lipid homeostasis during cellular stress?

SPAC1639.01c likely plays a critical role in membrane lipid homeostasis during cellular stress, particularly in maintaining appropriate membrane fluidity and composition. Fatty acid elongation enzymes are essential for producing the diverse fatty acid species that contribute to membrane properties.

Research on related systems suggests that elongation of fatty acids proteins contribute to stress adaptation by modifying membrane lipid composition, particularly by adjusting the ratio of saturated to unsaturated fatty acids and altering acyl chain length . During stresses such as temperature shifts, nutrient deprivation, or oxidative stress, these modifications help maintain appropriate membrane fluidity and function.

To investigate this role specifically for SPAC1639.01c, researchers should:

  • Analyze lipid composition changes in wild-type versus SPAC1639.01c mutant strains during various stress conditions using lipidomics

  • Examine growth phenotypes and membrane properties of mutants under stress

  • Study the regulation of SPAC1639.01c expression and activity during stress responses

  • Investigate potential coordination with other fatty acid metabolism enzymes and stress response pathways

Research should particularly focus on cytoplasmic freezing phenomena during glucose starvation, where diffusive motion of lipid granules and other structures becomes restricted , to determine if SPAC1639.01c-mediated changes in membrane lipid composition contribute to this response.

How do post-translational modifications regulate SPAC1639.01c activity?

Although specific information about post-translational modifications (PTMs) of SPAC1639.01c is limited in the provided search results, regulation of fatty acid elongation enzymes typically involves multiple PTMs that fine-tune activity in response to cellular conditions. Based on studies of related enzymes, researchers should investigate several likely regulatory mechanisms:

  • Phosphorylation: Potential phosphorylation sites in SPAC1639.01c should be identified through bioinformatic prediction and confirmed by mass spectrometry. Researchers should create phosphomimetic and phospho-deficient mutants to assess the impact on enzyme activity, localization, and protein interactions.

  • Ubiquitination: This modification may regulate protein turnover and could be assessed through immunoprecipitation under denaturing conditions followed by ubiquitin-specific antibody detection.

  • Acetylation/Sumoylation: These modifications may affect enzymatic activity or localization and should be investigated using specific antibodies and mass spectrometry approaches.

  • Membrane environment: While not a direct PTM, the lipid environment can significantly affect membrane protein function and should be investigated as a regulatory mechanism.

Researchers should also examine how these modifications change under different growth conditions, nutrient availability, or stress responses, potentially linking SPAC1639.01c activity to broader cellular signaling networks that respond to metabolic states.

How should researchers optimize experimental conditions for studying SPAC1639.01c?

Optimizing experimental conditions for studying SPAC1639.01c requires careful consideration of multiple factors:

ParameterOptimization ApproachRationale
Growth mediumCompare minimal vs. rich media with various carbon sourcesDifferent media compositions affect expression and activity of lipid metabolism enzymes
Cell growth phaseAnalyze expression and activity across log, early stationary, and late stationary phasesFatty acid metabolism changes significantly across growth phases
TemperatureTest standard (30°C) and stress temperatures (20°C, 37°C)Temperature affects membrane composition requirements
Extraction buffersOptimize detergent type and concentration (e.g., digitonin, DDM, CHAPS)Critical for maintaining membrane protein structure and interactions
Enzyme assay conditionsSystematically vary pH, ion concentrations, and cofactorsEnzymatic activity is highly dependent on reaction conditions

Researchers should first establish baseline expression conditions using quantitative RT-PCR or Western blotting with specific antibodies to determine when SPAC1639.01c is most abundant. For activity assays, it's critical to determine substrate preferences through in vitro assays with various acyl-CoA chain lengths and saturation states. When studying protein-protein interactions, gentler detergents and crosslinking approaches may better preserve transient or weak interactions that are often critical in multi-enzyme complexes involved in lipid metabolism .

What controls are essential when manipulating SPAC1639.01c expression?

When manipulating SPAC1639.01c expression through knockout, knockdown, or overexpression approaches, several essential controls must be implemented:

  • Genetic rescue controls: For knockout studies, expressing the wild-type gene from a plasmid should rescue phenotypes, confirming specificity. Testing rescue with mutated versions can identify critical residues.

  • Empty vector controls: For overexpression studies, empty vector transformants must be used to control for transformation effects.

  • Non-targeting RNA controls: For RNAi approaches, non-targeting RNA sequences with similar GC content should be used.

  • Expression level verification: Quantitative Western blotting or qRT-PCR must confirm actual changes in protein or mRNA levels.

  • Off-target effect assessment: RNA-seq or targeted qPCR of related genes should verify specificity of manipulation.

  • Phenotypic controls: Testing known phenotypes of fatty acid elongation defects (e.g., membrane fluidity changes, growth defects under specific conditions) provides functional validation.

  • Complementary approaches: Using both overexpression and knockdown/knockout approaches provides stronger evidence for function.

Additionally, researchers should consider genetic redundancy, as S. pombe may have other enzymes with overlapping functions that could mask phenotypes in single gene manipulations .

How can researchers distinguish between direct and indirect effects when studying SPAC1639.01c function?

Distinguishing between direct and indirect effects when studying SPAC1639.01c function presents a significant challenge due to the interconnected nature of lipid metabolism pathways. Researchers should employ several complementary strategies:

  • Acute vs. chronic manipulation: Compare acute inhibition (e.g., using temperature-sensitive alleles or chemical inhibitors) with long-term genetic knockouts. Direct effects typically manifest immediately after acute inhibition, while indirect effects may require more time.

  • In vitro reconstitution: Purify SPAC1639.01c and test its activity in a defined system with specific substrates. Direct enzymatic activities can be confirmed in isolation from cellular context.

  • Time-course analyses: Monitor changes in lipid profiles, gene expression, and cellular phenotypes at multiple time points after manipulation. Direct effects typically occur earlier than downstream consequences.

  • Substrate tracing: Use isotope-labeled substrates (e.g., 13C-labeled fatty acids) to track specific metabolic fates with and without functional SPAC1639.01c, similar to approaches used in AdipoR2 studies .

  • Catalytic mutants: Compare phenotypes of catalytic mutants (affecting enzyme activity) with complete knockout to differentiate between catalytic and potential scaffolding functions.

  • Targeted lipidomics: Focus analysis on direct products and substrates of the elongation reaction rather than global lipid changes, which may represent adaptations to primary defects.

  • Genetic interaction studies: Systematic analysis of genetic interactions can help place the gene within specific pathways and identify functional relationships.

How should researchers interpret lipidomic data in SPAC1639.01c studies?

Interpreting lipidomic data in SPAC1639.01c studies requires rigorous analytical approaches and careful consideration of metabolic interconnections. Researchers should follow these methodological principles:

  • Substrate specificity analysis: Determine which fatty acid species show the most significant changes when SPAC1639.01c is manipulated. Analyze patterns based on chain length and saturation to identify the specific step in fatty acid elongation affected. For example, accumulation of C16-C18 fatty acids with depletion of C20+ species would suggest a role in elongation beyond C18.

  • Lipid class distribution: Assess changes across different lipid classes (phospholipids, triglycerides, etc.) to determine how altered fatty acid elongation affects lipid distribution. This approach can identify compensatory mechanisms activated when elongation is disrupted.

  • Precursor-product relationships: Employ 13C-labeled fatty acid precursors to track metabolic fates with high precision, similar to approaches used in AdipoR2 studies . This allows distinction between direct products of the elongation reaction and downstream metabolites.

  • Temporal dynamics: Analyze changes at multiple time points after perturbation to distinguish immediate effects from adaptive responses.

  • Statistical approaches:

    • Principal component analysis to identify major sources of variation

    • Pathway enrichment analysis to determine most affected lipid pathways

    • Correlation networks to identify co-regulated lipid species

  • Integration with other data types: Combine lipidomic data with transcriptomics, proteomics, and phenotypic data to build a comprehensive model of SPAC1639.01c function.

When comparing wild-type and mutant conditions, researchers should establish clear criteria for biological significance beyond statistical significance, considering both fold-change and absolute abundance changes.

What approaches help resolve contradictory results in SPAC1639.01c research?

Resolving contradictory results in SPAC1639.01c research requires systematic investigation of potential sources of variation and careful experimental design. Researchers should implement these methodological approaches:

  • Strain background verification: Confirm the genetic background of all strains through genome sequencing or marker analysis, as background mutations can significantly affect lipid metabolism phenotypes.

  • Growth condition standardization: Develop precise protocols for media preparation, growth phase harvesting, and environmental conditions, as fatty acid metabolism is highly responsive to growth conditions.

  • Methodological validation: Compare different analytical techniques (e.g., GC-MS vs. LC-MS for fatty acid analysis) using identical samples to determine if contradictions arise from methodological differences.

  • Genetic interaction mapping: Systematically test interactions with other genes in fatty acid metabolism pathways to determine context-dependent functions that might explain variable results.

  • Complementation analysis: Use cross-species complementation to test functional conservation and identify species-specific aspects of SPAC1639.01c function.

  • Meta-analysis: Systematically compare experimental conditions across contradictory studies to identify variables that correlate with different outcomes.

  • Consortium approaches: Establish multi-laboratory studies with standardized protocols to distinguish robust findings from lab-specific results.

Researchers should particularly focus on potential redundancy with other elongation enzymes and compensatory mechanisms that might activate when SPAC1639.01c function is compromised, as these can lead to context-dependent phenotypes that appear contradictory.

What are emerging technologies for studying fatty acid elongation proteins?

Several emerging technologies offer promising new approaches for studying fatty acid elongation proteins like SPAC1639.01c:

  • Cryo-electron microscopy (Cryo-EM): Recent advances in cryo-EM technology now enable structural determination of membrane protein complexes in near-native states . This approach could resolve the structure of SPAC1639.01c alone or in complex with other elongation machinery components.

  • Proximity labeling proteomics: Techniques like TurboID and APEX2 allow in vivo identification of protein interaction networks with temporal resolution, which is particularly valuable for studying dynamic complexes involved in lipid metabolism.

  • Optogenetic control: Light-controlled activation or inhibition of SPAC1639.01c could enable precise temporal studies of fatty acid elongation without the confounding effects of long-term genetic manipulations.

  • CRISPR-based screening: Genome-wide CRISPR screens in S. pombe can identify genetic interactions and potential regulators of SPAC1639.01c function.

  • Single-cell lipidomics: Emerging methods for single-cell analysis of lipids can reveal cell-to-cell heterogeneity in fatty acid elongation activity and response to perturbations.

  • Nanoscale secondary ion mass spectrometry (NanoSIMS): This technique can visualize the subcellular localization of isotope-labeled fatty acids, providing spatial information about elongation activities.

  • Synthetic biology approaches: Reconstituting minimal fatty acid elongation systems in artificial membranes or lipid droplets could isolate the specific functions of individual components like SPAC1639.01c.

These technologies, combined with established approaches, will provide unprecedented insights into the structure, function, and regulation of fatty acid elongation systems.

How might research on SPAC1639.01c contribute to understanding human disease?

Research on SPAC1639.01c has significant potential to advance our understanding of human diseases related to fatty acid metabolism and membrane homeostasis:

  • Metabolic disorders: Insights into the fundamental mechanisms of fatty acid elongation can inform our understanding of conditions like insulin resistance, obesity, and type 2 diabetes, where altered fatty acid profiles contribute to pathology. The relationship between S. pombe elongation systems and mammalian adiponectin receptor pathways suggests evolutionary conservation of critical regulatory mechanisms .

  • Neurodegenerative diseases: Many neurodegenerative conditions involve altered membrane lipid composition. Research with model organisms like S. pombe can elucidate how perturbations in fatty acid elongation affect membrane properties and cellular functions relevant to neurodegeneration.

  • Cancer metabolism: Cancer cells often exhibit altered lipid metabolism to support rapid proliferation. Understanding the basic mechanisms of fatty acid elongation regulation could identify new therapeutic targets in cancer-specific metabolic pathways.

  • Genetic disorders of lipid metabolism: Several human genetic disorders result from mutations in ELOVL family proteins, which are functional analogs of SPAC1639.01c. S. pombe research can provide model systems to study the cellular consequences of these mutations in a simplified context.

  • Drug development: SPAC1639.01c studies could identify conserved structural features and regulatory mechanisms that could be targeted pharmacologically in human elongation enzymes, potentially leading to new therapeutics for disorders of lipid metabolism.

The advantages of S. pombe as a model organism, including its genetic tractability and closer relationship to human cells in many aspects compared to S. cerevisiae , make it particularly valuable for translational research connecting basic fatty acid metabolism to human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.