Recombinant Schizosaccharomyces pombe Putative metal ion transporter C17A12.14 (SPAC17A2.14, SPAC17G6.01)

What is the structural characterization of the S. pombe putative metal ion transporter C17A12.14?

The putative metal ion transporter C17A12.14 is a full-length protein consisting of 617 amino acids. Its complete amino acid sequence begins with MPSNTSRSVPTGFYYKQNARMQNRPRFSDRK and continues through the entire protein sequence as documented in the UniProt database (UniProt ID: O13779) . The protein's expression region spans from amino acid position 1 to 617, covering the entire protein length. The protein likely contains transmembrane domains characteristic of metal ion transporters, though specific structural analyses would require additional experimental confirmation through methods like X-ray crystallography or cryo-electron microscopy to determine its precise three-dimensional structure. Based on sequence homology, this protein appears to function in metal ion transport, a critical process for metal homeostasis in S. pombe.

How is the S. pombe putative metal ion transporter C17A12.14 classified in relation to other metal transporters?

The S. pombe putative metal ion transporter C17A12.14 is classified based on its sequence characteristics and predicted function rather than experimentally verified transport activity. Its classification can be approached through several analytical methods:

• Sequence alignment with known transporters: Comparing the protein sequence with characterized metal transporters from other organisms using BLAST or multiple sequence alignment tools.

• Domain identification: Analyzing the presence of conserved domains common to metal transporters using databases like Pfam or PROSITE.

• Phylogenetic analysis: Constructing evolutionary trees to determine its relationship to known transporter families.

While specific classification data isn't available in the provided materials, the protein's annotation as a "putative metal ion transporter" suggests sequence or structural similarities to known metal transporter families . For definitive classification, researchers should conduct transport assays and substrate specificity studies to confirm its functional categorization within established transporter families.

What are the optimal conditions for handling recombinant S. pombe C17A12.14 protein in laboratory settings?

The optimal handling conditions for recombinant S. pombe C17A12.14 protein include careful attention to storage, thawing protocols, and working concentrations:

Storage protocol:

• Store at -20°C for regular use

• For extended storage periods, maintain at -80°C to preserve protein integrity

• Avoid repeated freeze-thaw cycles as this significantly degrades protein quality

• Prepare working aliquots and store at 4°C for up to one week to minimize freeze-thaw cycles

Buffer composition:

• The protein is optimally maintained in a Tris-based buffer supplemented with 50% glycerol

• This buffer composition helps maintain protein stability and prevents aggregation

Handling recommendations:

• Thaw protein aliquots on ice when removing from frozen storage

• Centrifuge briefly after thawing to collect contents at the bottom of the tube

• Use appropriate protein concentration assays (Bradford or BCA) to verify concentration before experiments

• Consider adding protease inhibitors when working with the protein for extended periods

These conditions ensure maximum stability and functionality of the recombinant protein for various experimental applications including enzymatic assays, binding studies, and structural analyses.

What methodologies are most effective for studying the metal binding properties of the S. pombe C17A12.14 transporter?

Several complementary methodologies are particularly effective for investigating the metal binding properties of S. pombe C17A12.14 transporter:

• Isothermal Titration Calorimetry (ITC):

  • Directly measures binding affinities (Kd) between the purified transporter and various metal ions

  • Provides thermodynamic parameters (ΔH, ΔS, ΔG) of the binding interaction

  • Requires 0.5-2 mg of purified protein per experiment

• Metal-Binding Assays with Radioactive Isotopes:

  • Incubate purified protein with radioactive metal ions (e.g., ⁶⁵Zn, ⁶⁴Cu, ¹⁰⁹Cd)

  • Separate bound and unbound metal using size exclusion chromatography or filtration

  • Quantify binding using scintillation counting

• Fluorescence Spectroscopy:

  • Monitor intrinsic tryptophan fluorescence changes upon metal binding

  • Alternatively, use metal-sensitive fluorescent probes

  • Provides information about conformational changes induced by metal binding

• Functional Transport Assays:

  • Express the transporter in S. pombe mutants lacking endogenous metal transporters

  • Measure cellular metal uptake using atomic absorption spectroscopy or ICP-MS

  • Compare transport rates in the presence of different metal ions to determine specificity

• Site-Directed Mutagenesis:

  • Identify putative metal-binding residues through sequence analysis

  • Create point mutations at these sites

  • Test mutant proteins for altered metal binding properties

By combining these methodologies, researchers can comprehensively characterize the metal binding properties, specificity, and transport mechanism of the C17A12.14 protein. Integration with in vivo studies in S. pombe could further correlate biochemical findings with physiological functions, particularly in the context of metal homeostasis and detoxification pathways.

What is the role of the S. pombe C17A12.14 transporter in metal homeostasis and detoxification pathways?

The S. pombe C17A12.14 transporter likely plays a significant role in metal homeostasis and detoxification pathways, although its precise function requires further experimental validation. Based on current understanding of metal homeostasis in S. pombe:

The protein may function within a complex network of metal detoxification mechanisms in S. pombe, which represents a well-characterized model for studying metal homeostasis . S. pombe employs a sophisticated phytochelatin-dependent pathway as its primary mechanism for cadmium detoxification . This pathway involves several steps:

• Synthesis of phytochelatins (PCs) from glutathione by phytochelatin synthase (PCS)

• Binding of metal ions (particularly Cd²⁺, Cu²⁺, AsO₄³⁻, and AsO₂⁻) by the phytochelatins

• Transport of PC-metal complexes into the vacuole via ABC-type transporters

The C17A12.14 transporter may function at one of several points in this pathway:

• As a plasma membrane transporter controlling initial metal ion uptake

• As an intracellular transporter shuttling metals between compartments

• As a component interacting with other metal homeostasis proteins

Genome-wide screening for cadmium tolerance in S. pombe has identified several key genes involved in this process, including zip1Δ, spc1Δ, hmt1Δ, hmt2Δ, and pcs1Δ . The functional relationship between C17A12.14 and these known factors would be a valuable area for further investigation to definitively establish its role in metal homeostasis pathways.

How does the function of S. pombe C17A12.14 compare to similar transporters in other model organisms?

Comparative analysis of S. pombe C17A12.14 with metal transporters in other model organisms reveals both conserved mechanisms and species-specific adaptations in metal homeostasis:

Comparison with Saccharomyces cerevisiae:

Comparison with plants:

• S. pombe serves as an excellent model for studying phytochelatin-dependent metal detoxification in plants due to shared mechanisms

• Both use phytochelatins as the primary mechanism for cadmium detoxification

• Plants lacking phytochelatin synthesis show hypersensitivity to cadmium, similar to PC-deficient S. pombe mutants

• PC-Cd complexes are transported into the vacuole by ABC-type transporters in both systems

Functional conservation analysis:

• Sequence homology searches could identify potential functional homologs in other organisms

• Complementation studies (expressing C17A12.14 in mutants of other species lacking their native transporters) would demonstrate functional conservation

• Structural comparisons could reveal conserved metal-binding domains and transport mechanisms

This comparative approach highlights the value of S. pombe as a model system for understanding fundamental mechanisms of metal homeostasis across eukaryotes, particularly in plant cells where similar phytochelatin-dependent pathways operate .

How can the S. pombe C17A12.14 transporter be utilized in studying metal toxicity mechanisms in eukaryotic systems?

The S. pombe C17A12.14 transporter offers several sophisticated approaches for investigating metal toxicity mechanisms in eukaryotic systems:

• Gene Knockout/Knockdown Studies:

  • Generate C17A12.14 deletion mutants in S. pombe

  • Compare metal sensitivity profiles (IC₅₀ values) for various metals (Cd²⁺, Cu²⁺, Zn²⁺, etc.)

  • Perform transcriptome analysis to identify compensatory pathways activated in the absence of C17A12.14

• Integration with Known Metal Response Pathways:

  • Perform epistasis analysis with known metal response factors (e.g., pcs1, hmt1, spc1)

  • Create double mutants to determine genetic interactions

  • Map the position of C17A12.14 in the hierarchical response to metal stress

• Cellular Metal Distribution Studies:

  • Use fluorescent metal sensors or synchrotron X-ray fluorescence microscopy to track metal localization

  • Compare wild-type and C17A12.14 mutant cells to determine changes in metal compartmentalization

  • Correlate metal distribution with cellular toxicity markers

• System-Level Analysis:

  • Perform proteomics analysis to identify C17A12.14 interaction partners under different metal stress conditions

  • Use metabolomics to measure changes in small molecule profiles (glutathione, phytochelatins, amino acids)

  • Integrate data into computational models of metal homeostasis

• Translational Applications:

  • Express C17A12.14 in plant systems to evaluate its potential for enhancing metal tolerance

  • Investigate whether manipulation of this transporter could enhance phytoremediation approaches

These research applications leverage the extensive genetic tools available for S. pombe and the well-characterized nature of its metal detoxification pathways . By positioning C17A12.14 within the broader context of cellular metal homeostasis, researchers can gain insights applicable to metal toxicity mechanisms across eukaryotic systems, particularly in understanding how cells differentiate between essential and toxic metals.

What experimental design would best elucidate the interaction between S. pombe C17A12.14 and the phytochelatin-dependent detoxification pathway?

A comprehensive experimental design to elucidate the interaction between S. pombe C17A12.14 and the phytochelatin-dependent detoxification pathway would involve multiple complementary approaches:

Phase 1: Genetic Interaction Analysis

• Generate single and double knockout strains:

  • C17A12.14Δ

  • pcs1Δ (phytochelatin synthase)

  • hmt1Δ (vacuolar PC-Cd transporter)

  • C17A12.14Δ/pcs1Δ

  • C17A12.14Δ/hmt1Δ

• Quantitative cadmium sensitivity assays:

  • Measure growth rates at increasing cadmium concentrations (0-100 μM)

  • Calculate IC₅₀ values for each strain

  • Analyze genetic interactions (synergistic, additive, or epistatic relationships)

Phase 2: Biochemical Pathway Analysis

• Measure phytochelatin synthesis:

  • Quantify PC levels in wild-type vs. C17A12.14Δ using HPLC or LC-MS

  • Analyze PC synthesis kinetics following cadmium exposure

  • Determine if C17A12.14 affects PC synthesis or just transport

• Metal-PC complex formation and transport:

  • Isolate vacuoles from wild-type and mutant strains

  • Quantify vacuolar cadmium content using ICP-MS

  • Compare PC-Cd complex formation using size exclusion chromatography

Phase 3: Subcellular Localization and Interaction Studies

• Determine C17A12.14 localization:

  • Create GFP-tagged C17A12.14

  • Analyze subcellular localization using confocal microscopy

  • Examine colocalization with known components of PC pathway

• Identify physical interactions:

  • Perform co-immunoprecipitation with tagged C17A12.14

  • Conduct yeast two-hybrid or proximity labeling (BioID) assays

  • Validate interactions using in vitro binding assays

Phase 4: Transcriptional Regulation Analysis

• Analyze expression patterns:

  • Measure C17A12.14 expression under different metal stresses

  • Compare with expression patterns of pcs1, hmt1, and other metal response genes

  • Identify common regulatory elements

• Chromatin immunoprecipitation:

  • Identify transcription factors regulating C17A12.14

  • Determine if the same factors regulate other components of the PC pathway

This experimental design would generate a comprehensive understanding of how C17A12.14 integrates with the phytochelatin-dependent pathway, which represents the main cadmium detoxification mechanism in S. pombe . The results could establish whether C17A12.14 functions upstream, downstream, or in parallel to the known components of this pathway.

What are the common challenges in expression and purification of recombinant S. pombe C17A12.14, and how can they be addressed?

Researchers frequently encounter several challenges when expressing and purifying recombinant S. pombe C17A12.14, a putative metal ion transporter. These challenges and their solutions include:

Challenge 1: Low expression levels

• Solution: Optimize codon usage for the expression host

• Explore different expression systems (bacterial, yeast, insect, mammalian)

• Test various induction conditions (temperature, inducer concentration, time)

• Consider using stronger promoters or increasing copy number

Challenge 2: Protein insolubility and aggregation

• Solution: Express the protein as fusion with solubility-enhancing tags (MBP, SUMO, Trx)

• Lower the expression temperature (16-20°C) to slow folding

• Add specific metal ions during expression that might stabilize the protein

• Include mild detergents or lipids during extraction for this membrane protein

• Consider expressing selective domains rather than the full-length protein

Challenge 3: Protein instability during purification

• Solution: Maintain the protein in optimized buffer conditions (Tris-based buffer with 50% glycerol)

• Add protease inhibitors throughout the purification process

• Minimize purification steps and processing time

• Keep the protein at 4°C during purification

• Avoid repeated freeze-thaw cycles by preparing single-use aliquots

Challenge 4: Limited functional activity

• Solution: Verify proper folding using circular dichroism spectroscopy

• Ensure the presence of required cofactors or metal ions

• Reconstitute the protein into liposomes for functional studies

• Test activity immediately after purification

Challenge 5: Tag interference with function

• Solution: Design constructs with cleavable tags

• Compare activity before and after tag removal

• Test both N- and C-terminal tag placements

• Consider tag-free purification methods

A systematic approach to troubleshooting these challenges would involve carefully documenting each purification attempt, performing small-scale optimization experiments before scaling up, and verifying protein quality at each step using techniques like SDS-PAGE, Western blotting, and mass spectrometry.

How should researchers interpret conflicting data regarding metal specificity of the S. pombe C17A12.14 transporter?

When faced with conflicting data regarding the metal specificity of the S. pombe C17A12.14 transporter, researchers should implement a systematic approach to data reconciliation:

Analysis of Methodological Differences

• Experimental conditions comparison:

  • Evaluate differences in buffer composition, pH, temperature, and presence of competing ions

  • Assess whether in vitro vs. in vivo methods were used, as cellular environment may contain cofactors

  • Compare protein preparation methods (purification tags, detergents, reconstitution systems)

• Measurement technique evaluation:

  • Direct binding methods (ITC, SPR) vs. functional transport assays

  • Sensitivity and detection limits of different analytical techniques

  • Time resolution of measurements (equilibrium vs. kinetic determinations)

Statistical Reanalysis

• Quantitative assessment:

  • Calculate effect sizes and confidence intervals for all reported specificity measurements

  • Perform meta-analysis of available data where possible

  • Evaluate statistical power of conflicting studies

• Rigorous controls:

  • Check for proper negative controls (non-transporter proteins)

  • Verify positive controls (known metal transporters)

  • Evaluate potential contamination with other metals

Biological Context Considerations

• Physiological relevance:

  • Compare tested metal concentrations with physiological levels in S. pombe

  • Consider the role of the phytochelatin-dependent pathway in metal specificity

  • Evaluate metal speciation under experimental conditions

• Experimental design to resolve conflicts:

  • Direct competition assays between metals

  • Structure-function studies with mutations in predicted metal-binding sites

  • Comparative analysis with related transporters of known specificity

Proposed Resolution Framework

By systematically addressing these aspects, researchers can reconcile conflicting data and develop a more nuanced understanding of the metal specificity profile of the S. pombe C17A12.14 transporter. This approach acknowledges that apparent conflicts may reflect real biological complexity rather than experimental error, as metal transporters often exhibit overlapping specificities influenced by cellular context.

What are the promising avenues for applying knowledge about S. pombe C17A12.14 to environmental bioremediation research?

Several promising research avenues exist for applying knowledge about S. pombe C17A12.14 to environmental bioremediation:

• Engineered Bioremediating Organisms:

  • Overexpression of C17A12.14 in metal-accumulating organisms

  • Creation of synthetic microbial consortia with enhanced metal uptake capabilities

  • Development of biosensor systems using C17A12.14 promoter regions to detect bioavailable metals

• Enhanced Phytoremediation Systems:

  • Transfer of C17A12.14 or optimized variants into plants used for phytoremediation

  • Integration with phytochelatin-dependent pathways already present in plants

  • Cross-species comparative analysis to identify optimal transporter variants for specific metals

• Bioremediation Process Optimization:

  • Characterization of optimal environmental conditions (pH, temperature, competing ions) for C17A12.14 function

  • Development of immobilized cell systems expressing C17A12.14 for continuous bioremediation

  • Design of bioreactors optimized for metal sequestration via C17A12.14-mediated transport

• Molecular Mechanism Elucidation for Biotechnological Applications:

  • Structure-function analysis to identify critical residues determining metal specificity

  • Protein engineering to enhance selectivity for specific toxic metals

  • Computational modeling to predict transporters with optimal properties for target pollutants

• Integration with Existing Metal Detoxification Pathways:

  • Studies combining C17A12.14 with phytochelatin synthesis and transport systems

  • Development of multi-component systems that enhance both uptake and sequestration

  • Metabolic engineering to increase glutathione production as precursor for phytochelatins

These research directions build upon the understanding that S. pombe uses a phytochelatin-dependent pathway as its main cadmium detoxification mechanism , potentially allowing for the development of more efficient bioremediation technologies that mimic or enhance natural detoxification processes. Success in these approaches would require detailed characterization of C17A12.14's metal transport kinetics, specificity, and regulation, combined with systems biology approaches to understand its interaction with other components of cellular metal homeostasis.