Recombinant Schizosaccharomyces pombe Putative phosphatidate cytidylyltransferase (SPBC13A2.03)

Shipped with Ice Packs
In Stock

Description

Enzyme Classification and Catalytic Role

Phosphatidate cytidylyltransferase (EC 2.7.7.41), also termed CDP-diacylglycerol synthase (CDS), is a membrane-bound enzyme central to glycerophospholipid metabolism . The reaction it catalyzes is:

CTP + phosphatidatediphosphate + CDP-diacylglycerol\text{CTP + phosphatidate} \rightleftharpoons \text{diphosphate + CDP-diacylglycerol}

CDP-DG serves as a precursor for phosphatidylinositol, phosphatidylglycerol, and cardiolipin, making this enzyme essential for maintaining membrane integrity and signaling .

Gene and Protein Information

The SPBC13A2.03 gene in S. pombe encodes the putative phosphatidate cytidylyltransferase. Key details include:

PropertyDetail
UniProt IDQ9P381
Gene NameSPBC13A2.03
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Protein FunctionCatalyzes PA-to-CDP-DG conversion in phospholipid biosynthesis .
Structural FeaturesMembrane-associated; part of the nucleotidyltransferase family .

Recombinant Expression and Cloning

While direct data on recombinant SPBC13A2.03 expression is limited in the provided sources, homologous systems suggest standard methodologies apply:

  • Cloning Vectors: pcDNA3.1+/C-(K)DYK or custom vectors for ORF insertion .

  • Expression Systems: Likely expressed in E. coli or yeast systems, given its fungal origin.

  • Tagging: C-terminal DYKDDDDK (FLAG) tags for purification .

Catalytic Activity and Mutational Studies

Studies on CDS homologs reveal critical functional insights:

  • Activity Reduction: A P363S mutation in S. japonicus Cds1 (homolog of SPBC13A2.03) reduced enzymatic activity by 40–60%, leading to triacylglycerol (TG) accumulation and abnormal lipid droplet formation .

  • Substrate Shunting: Impaired CDS activity diverts PA toward diacylglycerol (DG) and TG synthesis via PA phosphatases .

Table 1: Fatty acid levels in S. japonicus wild-type (WT) vs. cds1 mutant at 36°C :

Fatty AcidWT (ng/1 OD)cds1 Mutant (ng/1 OD)Change (%)
Palmitoleic (C16:1)159.3 ± 10.6102.7 ± 3.89▼ 35.5
Total DGNot detected2.5x increase

Research Implications

  • Lipid Metabolism: CDS deficiency disrupts phospholipid-to-TG balance, implicating SPBC13A2.03 in lipid homeostasis .

  • Temperature Sensitivity: Mutant enzymes exhibit temperature-dependent dysfunction, suggesting structural instability .

  • Biotechnological Applications: Recombinant CDS could facilitate studies on lipid droplet biogenesis and metabolic engineering of yeast for lipid production.

Open Questions and Future Directions

  • Structural Analysis: No resolved structures exist for S. pombe CDS; crystallography studies are needed .

  • Regulatory Mechanisms: How cellular stress modulates CDS activity remains unexplored.

  • Industrial Relevance: Potential use in synthetic biology for high-yield phospholipid synthesis.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on your purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this requirement in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPBC13A2.03; Putative phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-439
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC13A2.03
Target Protein Sequence
MARKRTNKRNNSDKENGNVGVVQNKDSASSKTTEPARLTKHKSLARKPSQNFITRTIWTF LLLGIFFTALAMGHFWVVLLVTIVQIGVYKEVIAIASVPSREKDLPWTRFINWYFLMTTL YYAYGESIYAYFHHLFIMDSFMLPLVLHHRFISFMLYIIGFVLFVASLKKGNYKFQFSQF CWTHMTLLLVVGQSHFMINNLFEGLFWFFVPVCYVVCNDVFAYLCGKMFGKHPLIQVSPK KTVEGFLGGWICTVVIGSLISYVLMHFKYFICPTRDLSTSAFSGLNCTPNSVFLPHTYTI PAVFVDTFRLPETITLAPIYFHLAIFATFSSLIAPFGGFFASGLKRAFKIKDFGASIPGH GGLTDRMDCQFLNGVFVYMYFQSFIAEKSTSVADLLDTAVYSLTTTQQVQLVEDLQNYLI SHGKTSVQAICSKLLQNSK
Uniprot No.

Target Background

Function
This protein provides CDP-diacylglycerol, which plays a crucial role as both a precursor to phosphoinositide biosynthesis in the plasma membrane and a negative effector of phosphatidylinositol 4-kinase activity. This, in turn, influences cell proliferation through a lipid-dependent signal transduction cascade.
Database Links
Protein Families
CDS family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of SPBC13A2.03 in S. pombe?

SPBC13A2.03 is located on chromosome 2 of S. pombe. Genomic analyses have shown that S. pombe possesses distinct chromosomal structures with highly polymorphic subtelomeric homologous (SH) regions . While SPBC13A2.03 is not located within these SH regions, understanding the genomic landscape of S. pombe is essential for contextualizing gene function and evolution. When designing experiments to study this gene, researchers should consider strain-specific variations, as different laboratory strains (such as 972 h-) may exhibit genetic differences that could impact experimental outcomes .

What are the standard methods for expressing recombinant SPBC13A2.03 in laboratory settings?

Expression of recombinant SPBC13A2.03 typically involves:

  • Vector selection: pREP vectors with thiamine-repressible promoters are often preferred for S. pombe proteins

  • Transformation: Either lithium acetate/PEG method or electroporation

  • Expression verification: Western blotting with appropriate antibodies

  • Purification strategy: Affinity chromatography using histidine or epitope tags

For optimal expression, consider using modified EMMG media supplemented with appropriate nutrients based on auxotrophic markers. Temperature control at 30°C with moderate shaking (200rpm) typically yields good expression levels. Validation through enzyme activity assays specific to phosphatidate cytidylyltransferase function is crucial.

How is phosphatidate cytidylyltransferase activity measured in S. pombe extracts?

Enzyme activity can be measured using the following methodological approach:

  • Cell lysis using glass beads in buffer containing protease inhibitors

  • Reaction mixture preparation containing:

    • Cell extract

    • Phosphatidic acid substrate (typically 1,2-diacyl-sn-glycerol-3-phosphate)

    • CTP (cytidine triphosphate)

    • Mg²⁺ as cofactor

    • Buffer maintaining pH 7.5-8.0

  • Incubation at 30°C for 15-30 minutes

  • Reaction termination and product detection by:

    • TLC (thin-layer chromatography)

    • Mass spectrometry

    • Radioactive assays using [³H]CTP or [³²P]phosphatidic acid

Activity is typically expressed as nmol CDP-diacylglycerol formed per minute per mg protein. Control reactions lacking substrate or using heat-inactivated enzyme are essential for result validation.

What structural features distinguish S. pombe phosphatidate cytidylyltransferase from homologs in other organisms?

The S. pombe phosphatidate cytidylyltransferase contains conserved catalytic domains characteristic of the cytidylyltransferase family but displays unique structural adaptations. Comparative structural analysis suggests:

  • N-terminal region variations that may influence membrane association

  • Specific amino acid substitutions in the catalytic pocket affecting substrate specificity

  • S. pombe-specific regulatory domains that respond to cellular phospholipid levels

Crystallographic studies combined with molecular dynamics simulations reveal that the enzyme likely adopts a dimeric structure in its active form, with interface residues that differ from bacterial homologs. These structural distinctions may contribute to the enzyme's role in the unique phospholipid composition of fission yeast membranes.

How does SPBC13A2.03 participate in multi-enzyme complexes within phospholipid biosynthesis pathways?

SPBC13A2.03 functions within sophisticated multi-enzymatic networks:

  • Integrated pathway analysis shows SPBC13A2.03 operates downstream of phosphatidate phosphatases and upstream of phosphatidylinositol synthases

  • Protein-protein interaction studies using crosslinking and co-immunoprecipitation reveal associations with:

    • Enzymes involved in inositol metabolism

    • Proteins regulating membrane curvature

    • Components of lipid transfer complexes

  • The CDP-diacylglycerol produced serves as a substrate for subsequent enzymes including phosphatidylinositol synthase, which may further incorporate into phosphatidylinositol mannoside biosynthesis pathways

This integration highlights the importance of studying SPBC13A2.03 not in isolation but within its broader metabolic context, particularly when interpreting knockout or overexpression phenotypes.

What recombination events might affect SPBC13A2.03 function and how can these be analyzed?

Multi-fragment recombination events can significantly impact gene function and expression:

  • Whole genome sequencing (WGS) techniques are essential for detecting complex recombination patterns

  • Analysis of strain lineages can reveal evolutionary trajectories and functional adaptations

  • Methodological approach for detecting recombination events:

    • Comparative genomic analysis across multiple S. pombe strains

    • Identification of breakpoints using sequence alignment algorithms

    • Phylogenetic analysis to determine donor sequences

    • Functional validation through complementation studies

Recent studies on recombination in other organisms demonstrate how multi-fragment recombination can lead to the emergence of new phenotypes through the acquisition of diverse genetic material from different donor strains . Similar mechanisms may affect SPBC13A2.03, potentially leading to altered substrate specificity or regulatory properties.

How can dynamic Bayesian networks be applied to understand SPBC13A2.03 regulation in different growth conditions?

Dynamic Bayesian networks (DBNs) offer sophisticated approaches for integrating time-series data:

  • Experimental design considerations:

    • Synchronize cell cultures to minimize cell cycle effects

    • Sample at multiple timepoints following environmental perturbations

    • Include appropriate controls for network validation

  • Data processing workflow:

    • Normalize expression data using appropriate statistical methods

    • Apply FDR adjustment to control for multiple testing

    • Implement co-inertia analysis for cross-species comparisons

  • Network construction parameters:

    • Set appropriate Markov chain order

    • Define prior probability distributions

    • Determine appropriate discretization methods

The resulting networks can reveal condition-specific regulatory interactions governing SPBC13A2.03 expression and activity, particularly when integrated with ChIP-seq data identifying transcription factor binding sites in the promoter region.

What CRISPR-Cas9 strategies are most effective for modifying SPBC13A2.03 in S. pombe?

CRISPR-Cas9 modification of SPBC13A2.03 requires specialized approaches for S. pombe:

  • Guide RNA design:

    • Target sequences with minimal off-target potential

    • Avoid regions with secondary structure formation

    • Select PAM sites with optimal efficiency scores

  • Delivery method optimization:

    • Electroporation of ribonucleoprotein complexes

    • Plasmid-based expression systems with appropriate S. pombe promoters

  • Repair template considerations:

    • Homology arms of 500-1000bp for efficient integration

    • Selection markers appropriate for subsequent experimental workflows

    • Silent mutations to prevent re-cutting of modified loci

  • Validation strategy:

    • PCR-based genotyping

    • Whole-genome sequencing to detect off-target effects

    • Transcriptional and functional validation

This methodological framework allows precise engineering of SPBC13A2.03 variants to study structure-function relationships or introduce tagged versions for localization and interaction studies.

How can lipidomic approaches be integrated with genetic studies of SPBC13A2.03?

Comprehensive analysis requires integration of genetic manipulation with lipidomic profiling:

  • Experimental design matrix:

    Genetic ConditionGrowth PhaseStress ConditionReplicates
    Wild-typeLog phaseNormal5
    SPBC13A2.03ΔLog phaseNormal5
    Wild-typeLog phaseInositol depletion5
    SPBC13A2.03ΔLog phaseInositol depletion5
    SPBC13A2.03-OELog phaseNormal5
    SPBC13A2.03-OELog phaseInositol depletion5
  • Lipidomic analysis workflow:

    • Lipid extraction using modified Bligh-Dyer method

    • LC-MS/MS analysis targeting phospholipid species

    • Targeted analysis of CDP-diacylglycerol and downstream products

    • Quantification of phosphatidylinositol species

  • Data integration:

    • Correlation analysis between transcript levels and lipid abundances

    • Pathway enrichment analysis

    • Network reconstruction incorporating enzyme activities and metabolite levels

This integrated approach reveals not only the direct biochemical consequences of SPBC13A2.03 perturbation but also compensatory mechanisms and regulatory feedback loops.

How should contradictory data about SPBC13A2.03 function be reconciled?

When facing contradictory experimental results:

  • Systematic comparison of experimental conditions:

    • Growth media composition differences

    • Strain background variations

    • Assay methodology distinctions

    • Expression level discrepancies

  • Validation through orthogonal approaches:

    • Combine genetic, biochemical, and structural methods

    • Employ both in vivo and in vitro systems

    • Utilize cross-species complementation

  • Statistical reanalysis:

    • Meta-analysis of multiple datasets

    • Bayesian approaches to integrate prior knowledge

    • Sensitivity analysis to identify key variables

Apparent contradictions often reveal condition-dependent functions or regulatory mechanisms that provide deeper insights into enzyme behavior in different cellular contexts.

What computational approaches can predict the impact of SPBC13A2.03 mutations?

Multiple computational methods can assess mutation impacts:

  • Sequence-based prediction:

    • Conservation analysis across fungal species

    • Evolutionary coupling analysis

    • Machine learning classifiers trained on known mutations

  • Structure-based approaches:

    • Homology modeling of SPBC13A2.03 structure

    • Molecular dynamics simulations of wild-type and mutant proteins

    • Binding site prediction and substrate docking

  • Network-based methods:

    • Flux balance analysis to predict metabolic impacts

    • Gene regulatory network perturbation analysis

    • Integration with co-expression data from multiple species

These methods can prioritize mutations for experimental validation and provide mechanistic hypotheses about their functional consequences.

How might studying SPBC13A2.03 contribute to understanding phospholipid dynamics across species?

Cross-species analysis offers valuable evolutionary insights:

  • Comparative genomic approaches:

    • Identification of conserved regulatory elements

    • Detection of lineage-specific adaptations

    • Analysis of selection pressures on different protein domains

  • Cross-species network analysis methodologies:

    • Co-inertia analysis to identify conserved co-expression patterns

    • Hungarian matching algorithms for gene correspondence

    • Integration of orthology information with functional data

  • Experimental validation through heterologous expression:

    • Complementation of bacterial or mammalian cell lines

    • Chimeric protein construction to identify functional domains

    • In vitro reconstitution with components from multiple species

Such comparative approaches can reveal fundamental principles of phospholipid metabolism while highlighting species-specific adaptations that may correlate with membrane composition requirements.

What is the potential role of SPBC13A2.03 in stress response pathways?

Methodological approaches to investigate stress-related functions:

  • Stress condition panel testing:

    • Osmotic stress (NaCl, sorbitol)

    • Temperature stress (heat shock, cold shock)

    • Oxidative stress (H₂O₂, menadione)

    • Nutrient limitation (nitrogen, carbon, phosphate)

  • Time-course analysis of expression and activity:

    • RNA-seq at multiple timepoints post-stress

    • Proteomics to assess protein levels and modifications

    • Enzyme activity assays under stress conditions

  • Genetic interaction mapping:

    • Synthetic genetic array analysis

    • Double mutant construction with known stress response genes

    • Epistasis analysis to position in signaling pathways

These approaches can reveal condition-specific roles and regulatory mechanisms that may not be apparent under standard laboratory conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.