Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.04 (SPCC622.04)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPCC622.04; Putative uncharacterized membrane protein C622.04
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC622.04
Target Protein Sequence
MTQPDIEIVIKEDFTYRECSDVANDVFKKTQWLLYVFLFIIFANCVVDVKYYFEGFSHSL LFVYFFLTLIILLVSFMGFHYLNSIPKPEAEPDYRKKQESKNQDFLKSQSNEPLEYASSS AVELEKEKNTREGLTILESS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the general characterization of SPCC622.04 protein?

The SPCC622.04 protein is a putative uncharacterized membrane protein in Schizosaccharomyces pombe with structural characteristics similar to other membrane proteins in the species. Like other membrane proteins, it likely contains transmembrane domains that anchor it within the cellular membrane. Based on comparative analysis with similar proteins such as C750.05c (SPAC750.05c), it likely plays a role in membrane organization or transport processes . The protein follows the standard nomenclature for S. pombe genes, with "SP" indicating Schizosaccharomyces pombe, followed by the chromosomal location identifier.

What expression systems are most effective for recombinant production of SPCC622.04?

For the recombinant production of SPCC622.04, several expression systems can be utilized including E. coli, yeast, baculovirus, and mammalian cell systems . For membrane proteins like SPCC622.04, expression in E. coli often provides high yields but may present folding challenges. Yeast expression systems (particularly S. cerevisiae) offer advantages for eukaryotic membrane proteins due to similarity in membrane composition and post-translational machinery. For more complex functional studies requiring proper folding and post-translational modifications, baculovirus or mammalian expression systems may be preferable, though with lower yields and higher costs.

How does the SRP-dependent pathway affect the targeting of SPCC622.04?

The SPCC622.04 protein, like most membrane proteins, likely follows the Signal Recognition Particle (SRP)-dependent cotranslational targeting pathway . This evolutionarily conserved process involves the SRP RNA associated with the SRP54 protein recognizing the N-terminal signal sequence as it emerges from the ribosomal tunnel. The process occurs in three critical steps: (1) binding of the SRP54 M-domain to the signal sequence, (2) GTP-dependent interaction between SRP54 and SRP receptor domains forming a targeting complex at the membrane, and (3) delivery of the ribosome-nascent chain to the translocon, facilitated by GTP hydrolysis and structural rearrangements . This pathway is essential for proper localization and insertion of membrane proteins like SPCC622.04.

How might SPCC622.04 function relate to sexual differentiation in S. pombe?

The function of SPCC622.04 may potentially intersect with sexual differentiation pathways in S. pombe, particularly in nutrient-responsive signaling. S. pombe initiates sexual differentiation upon nutrient starvation, arresting in G1 phase when nutrients like nitrogen and glucose are depleted . As a membrane protein, SPCC622.04 could function in nutrient sensing or signal transduction pathways that regulate sexual differentiation. Current research indicates that several signaling pathways—including the glucose-sensing cAMP-PKA pathway, nitrogen-sensing TOR pathway, and stress-activating protein kinase pathway—are crucial for sexual differentiation in S. pombe . Experimental approaches to investigate SPCC622.04's role might include analyzing phenotypic effects of gene deletion or overexpression on mating efficiency, particularly under varying nutrient conditions.

What structural prediction methods are most reliable for modeling SPCC622.04?

Given the challenges in crystallizing membrane proteins for direct structural determination, computational prediction methods provide valuable insights for proteins like SPCC622.04. AlphaFold2 and RoseTTAFold have demonstrated remarkable accuracy for membrane protein structure prediction. Homology modeling using templates from the Protein Data Bank (PDB) can be effective if homologous membrane proteins with known structures exist . For SPCC622.04, a hybrid approach combining threading methods (which align sequences to known structural templates) with ab initio modeling for unique regions would likely yield the most reliable structural predictions. Model validation should include assessment of transmembrane topology predictions, hydrophobicity analysis, and evaluation of conserved structural motifs common to membrane proteins in S. pombe.

How can researchers distinguish between direct and indirect interactions of SPCC622.04 with other cellular components?

Distinguishing direct from indirect interactions requires complementary approaches. Proximity-based labeling methods such as BioID or APEX can identify proteins in close proximity to SPCC622.04 in vivo. These techniques involve fusing a biotin ligase or peroxidase to SPCC622.04, which then biotinylates nearby proteins that can be isolated and identified by mass spectrometry. For direct physical interactions, in vitro binding assays using purified SPCC622.04 and candidate interacting proteins are essential. Split-reporter systems (like split-GFP or split-luciferase) can provide spatiotemporal information about interactions in living cells. Validation through reverse co-immunoprecipitation experiments helps confirm the bidirectional nature of direct interactions, while genetic interaction mapping (synthetic lethality or epistasis analysis) can reveal functional relationships that may not involve direct physical contact .

What purification strategies yield the highest purity for recombinant SPCC622.04?

Effective purification of SPCC622.04 requires specialized approaches for membrane proteins. A recommended protocol begins with optimized cell lysis using either mechanical disruption (for yeast expressions) or sonication (for bacterial systems), followed by membrane fraction isolation through differential centrifugation. Solubilization of the membrane protein is critical; screening multiple detergents (including DDM, LMNG, or digitonin) at various concentrations is advisable to maintain protein stability and native conformation. For affinity purification, a polyhistidine tag system with IMAC (Immobilized Metal Affinity Chromatography) provides good initial capture, ideally followed by size exclusion chromatography to remove aggregates and achieve >90% purity . Throughout purification, maintaining glycerol in buffers helps preserve protein stability, and conducting the process at 4°C minimizes degradation. Final purified protein should be stored with glycerol at -20°C for short-term or -80°C for long-term storage .

What are the optimal approaches for studying SPCC622.04 insertion into membranes?

Investigating the membrane insertion of SPCC622.04 requires examining the role of membrane protein biogenesis machinery. The YidC/Oxa1/Alb3 family of membrane protein insertases and the EMC (ER Membrane protein Complex) are particularly relevant for proteins that may bypass or partially utilize the Sec61/SecY translocon . Research approaches should include in vitro reconstitution experiments using purified components of insertion machinery and synthetic liposomes containing SPCC622.04. Fluorescence-based assays utilizing position-specific labeled SPCC622.04 can track the insertion process in real-time. Crosslinking studies that capture transient interactions between SPCC622.04 and components of insertion machinery provide snapshots of the insertion process. Additionally, cryo-electron microscopy of SPCC622.04 during membrane insertion can reveal structural transitions that occur during the integration process.

How can researchers effectively analyze post-translational modifications of SPCC622.04?

Post-translational modifications (PTMs) of SPCC622.04 can significantly impact its function and interactions. A comprehensive PTM analysis workflow should begin with enrichment strategies specific to the modification of interest (e.g., phosphopeptide enrichment using titanium dioxide, glycopeptide enrichment using lectin affinity). Mass spectrometry-based proteomics, particularly using high-resolution instruments with electron transfer dissociation (ETD) fragmentation, offers the most sensitive detection of PTMs. For site-specific analysis, targeted mass spectrometry approaches like parallel reaction monitoring (PRM) or multiple reaction monitoring (MRM) provide quantitative information about modification occupancy at specific residues. Combining these methods with biological perturbations (e.g., kinase inhibitors, stress conditions) can reveal the regulatory mechanisms controlling SPCC622.04 modifications. Validation using site-specific antibodies or site-directed mutagenesis of modified residues helps confirm the functional significance of identified PTMs.

How should researchers approach contradictory results in SPCC622.04 functional studies?

Contradictory results in SPCC622.04 functional studies require systematic troubleshooting and careful examination of methodological differences. Begin by comparing experimental conditions in detail, including expression systems, purification methods, and assay conditions that may affect protein activity. Consider protein conformation and stability issues; membrane proteins are particularly sensitive to detergent choice and lipid environment . Design control experiments to test specific hypotheses about the source of contradictions, such as comparing protein from different expression systems in identical assays. Collaborate with laboratories reporting different results to directly compare materials and protocols. For truly contradictory findings that persist after methodological reconciliation, consider that SPCC622.04 may have context-dependent functions influenced by cellular conditions or interaction partners. Document all variables systematically and consider publishing comprehensive methods papers that address reproducibility challenges for this specific protein.

What bioinformatic approaches are most valuable for predicting SPCC622.04 function?

A multi-layered bioinformatic approach yields the most comprehensive functional predictions for uncharacterized proteins like SPCC622.04. Begin with sensitive sequence similarity searches using PSI-BLAST and HMM-based methods to identify distant homologs with known functions. Structural predictions using AlphaFold2 can reveal functional domains and potential binding pockets. Gene neighborhood analysis examining consistently co-occurring genes across species can suggest functional associations. For S. pombe specifically, correlation analysis of gene expression patterns across various conditions (particularly nutrient limitation and sexual differentiation conditions) may reveal co-regulated genes . Protein-protein interaction network analysis incorporating experimental data from similar membrane proteins provides functional context. Integration of these diverse approaches through machine learning algorithms that weight evidence from multiple sources often provides more reliable predictions than any single method.

What controls are essential when evaluating SPCC622.04 function in cellular contexts?

Rigorous experimental design for SPCC622.04 functional studies requires multiple control types. Genetic controls should include not only gene deletion (SPCC622.04Δ) strains but also point mutants affecting specific domains and a complementation strain where the wild-type gene is reintroduced to confirm phenotype rescue. Expression controls must verify protein levels using quantitative western blotting with appropriate loading controls, particularly when comparing mutant variants. Localization controls should confirm proper membrane insertion and cellular distribution using fluorescent protein tagging or fractionation experiments. Specificity controls utilizing closely related membrane proteins can distinguish general from protein-specific effects. When studying potential roles in nutrient sensing or sexual differentiation, controls for cell cycle stage and nutrient status are crucial, as these factors significantly influence S. pombe cellular processes . Finally, technical replicates (repeated measurements) and biological replicates (independent cultures or transformants) are essential to ensure reproducibility and distinguish biological variation from experimental noise.

How might comparative studies between SPCC622.04 and other membrane proteins inform function?

Comparative studies between SPCC622.04 and better-characterized membrane proteins, such as C750.05c (SPAC750.05c), can provide valuable insights into function through evolutionary relationships . Research should focus on identifying conserved structural motifs and sequence patterns across related proteins in S. pombe and other fungi. Particular attention should be paid to the "hydrophobic slide" features similar to those found in YidC-like insertases, which facilitate membrane protein insertion through interactions between specific transmembrane domains . Experimental approaches could include domain-swapping experiments to determine if functional domains from characterized proteins retain activity when transferred to SPCC622.04. Phylogenetic profiling across species with varying ecological niches can reveal evolutionary pressures and functional constraints on the protein. These comparative approaches are especially valuable when direct functional assays prove challenging for uncharacterized proteins.

What emerging technologies show promise for elucidating SPCC622.04 function?

Several cutting-edge technologies are particularly promising for studying uncharacterized membrane proteins like SPCC622.04. Cryo-electron microscopy advances now allow structural determination of membrane proteins in near-native lipid environments without crystallization. Single-molecule tracking using photoactivatable fluorescent proteins can reveal the dynamics and interactions of SPCC622.04 in living cells with nanometer precision. Proximity-dependent biotinylation methods (TurboID, miniTurbo) with improved temporal resolution can map the dynamic interactome of SPCC622.04 under various conditions. CRISPR-based genetic screens designed specifically for membrane protein function can uncover genetic interactions and phenotypes at scale. For functional characterization, microfluidic platforms that precisely control nutrient environments while monitoring single-cell responses can be particularly valuable for testing hypotheses about SPCC622.04's role in nutrient sensing or stress response pathways in S. pombe .

What are the most significant challenges remaining in SPCC622.04 research?

The primary challenges in SPCC622.04 research include functional annotation of this uncharacterized membrane protein without clear homologs of known function. This requires integrated approaches combining structural prediction, interaction studies, and phenotypic analysis. Technical challenges persist in membrane protein biochemistry, particularly in maintaining native conformation during purification and reconstitution experiments . The potential redundancy with other membrane proteins in S. pombe may mask phenotypes in single-gene deletion studies, necessitating more sophisticated genetic approaches. Additionally, if SPCC622.04 functions in specific environmental conditions or developmental stages, identifying the precise contexts where its function becomes essential remains challenging. Developing specific antibodies or activity assays also presents difficulties for proteins without known biochemical functions. Addressing these challenges will require collaborative efforts combining expertise in membrane protein biochemistry, S. pombe genetics, and advanced imaging and proteomics methodologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.