Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.07 (SPCC622.07)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling requests for specific tags.
Synonyms
SPCC622.07; Putative uncharacterized membrane protein C622.07
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC622.07
Target Protein Sequence
MASLDIHLYVKKDLTYGECVRVAKEKYKIIHRLLYISIIFLFLNYVVDIVCYVKNYNGFS FFCWVFLNLGVIGIIITVIIYYISIPKPDAESEFLNKPDSLNQNVGESQSNEPPKYTSTF MDELDKQD
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SPCC622.07 and what organism is it found in?

SPCC622.07 is a gene that encodes a putative uncharacterized membrane protein in Schizosaccharomyces pombe, commonly known as fission yeast. The gene is classified as protein-coding with Entrez Gene ID 2539276 . Schizosaccharomyces pombe is a unicellular eukaryote widely used as a model organism in molecular and cell biology research due to its relatively simple genome structure. The genome of S. pombe contains approximately 4,824 protein-coding genes, which is among the smallest number recorded for a eukaryote . SPCC622.07 represents one of the hypothetical proteins whose function has not yet been fully characterized, despite the complete genome sequencing of S. pombe.

What genomic resources are available for studying SPCC622.07?

Several genomic resources are available for researchers interested in SPCC622.07:

Resource TypeDetailsReference
cDNA ORF CloneCloneID: OSc98889, in vector pcDNA3.1-C-(k)DYKGenScript
Recombinant ProteinFull-length protein (1-128aa) with His-tagCreative Biomart
Genomic ContextAnnotated within NC_003421NCBI RefSeq
Related AccessionsNM_001023169.2 (mRNA), NP_588179.1 (protein)NCBI

The complete genome sequence of S. pombe provides valuable context for studying this gene in relation to the organism's approximately 4,824 protein-coding genes . As of 2018, this sequence was classified as "PROVISIONAL REFSEQ" indicating it had not yet been subject to final NCBI review at that time .

What expression systems are recommended for recombinant production of SPCC622.07?

Based on current research practices, E. coli expression systems have been successfully used for the recombinant production of SPCC622.07. Specifically, the full-length protein (amino acids 1-128) has been expressed in E. coli with an N-terminal His-tag . This approach utilizes standard prokaryotic expression methods that are suitable for many heterologous proteins.

When designing an expression strategy for membrane proteins like SPCC622.07, researchers should consider:

  • Expression vector selection: The documented success with pcDNA3.1-C-(k)DYK vectors suggests these are viable options . These vectors typically include strong promoters suitable for high-level expression.

  • Fusion tag strategy: N-terminal His-tags have been successfully employed , which facilitate downstream purification via immobilized metal affinity chromatography (IMAC).

  • Solubilization methods: As a membrane protein, SPCC622.07 may require careful optimization of detergent conditions to maintain proper folding during purification processes.

  • Codon optimization: When expressing yeast proteins in E. coli, codon optimization may improve expression efficiency by addressing codon usage bias differences between species.

While E. coli remains the predominantly documented system, eukaryotic expression systems such as insect cells or yeast might provide better folding environments for membrane proteins in cases where functional studies are paramount.

What are the optimal storage conditions for recombinant SPCC622.07?

Proper storage of recombinant SPCC622.07 is critical for maintaining protein integrity and activity. According to the product information, the following storage recommendations apply:

  • Long-term storage: Store at -20°C/-80°C upon receipt, with -80°C preferred for extended storage periods .

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been documented as an effective storage buffer . For working solutions, Tris-based buffer with 50% glycerol is recommended .

  • Aliquoting strategy: Upon receipt, the lyophilized protein should be briefly centrifuged before opening. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) added before aliquoting for long-term storage .

  • Working aliquots: Store at 4°C for up to one week .

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein degradation and loss of activity .

These storage conditions aim to preserve protein structure and prevent degradation, which is particularly important for structural and functional studies of membrane proteins.

How can researchers design experiments to characterize SPCC622.07 function?

Designing experiments to characterize the function of an uncharacterized protein like SPCC622.07 requires a systematic approach:

  • Hypothesis formulation: Start with a clear statement of the problem including variables. For example: "SPCC622.07 is involved in membrane integrity during meiosis in S. pombe" .

  • Variable identification:

    • Independent variables: Conditions to manipulate (e.g., growth phase, stress conditions)

    • Dependent variables: Measurable outcomes (e.g., growth rate, phenotypic changes)

    • Controlled variables: Factors to keep constant (e.g., temperature, media composition)

  • Experimental controls: Include appropriate controls such as wild-type strains or known membrane protein mutants for comparison .

  • Multi-method approach:

    • Gene deletion or mutation studies to observe phenotypic changes

    • Localization studies using GFP-tagging to determine subcellular distribution

    • Transcriptional analysis to identify conditions affecting expression

    • Protein-protein interaction studies to identify binding partners

  • Temporal considerations: Since S. pombe undergoes distinct phases during meiosis, temporal analysis of expression can be valuable. RNA-seq data collection at multiple time points (e.g., 0-10 hours at 2-hour intervals) during meiosis can reveal dynamic expression patterns .

A robust experimental design should include multiple biological replicates, appropriate statistical analysis methods, and consideration of potential experimental errors .

How can transcriptomics approaches be applied to study SPCC622.07 expression?

Transcriptomic analysis offers powerful insights into the expression patterns and potential regulatory mechanisms of SPCC622.07. Based on current research methodologies, the following approaches are recommended:

  • Temporal expression analysis: Collection of RNA samples at multiple time points (e.g., during cell cycle, meiosis, or stress response) can reveal dynamic expression patterns. For instance, researchers have collected S. pombe samples at 2-hour intervals from 0 to 10 hours during meiosis to capture temporal changes in gene expression .

  • RNA-seq implementation:

    • Short-read sequencing (Illumina) for quantitative expression analysis

    • Long-read sequencing (PacBio) for isoform discovery and alternative splicing analysis

    • Single-cell RNA-seq for cell-to-cell variability analysis

  • Data processing pipeline: The MultiRNAflow R package has been effectively used for integrated analysis of temporal transcriptomic data, supporting:

    • Data normalization

    • Principal Component Analysis (PCA)

    • Hierarchical clustering

    • Temporal clustering using Mfuzz

    • Differential expression analysis with DESeq2

  • Alternative splicing analysis: The SpliceHunter software tool can be employed to discover alternative splicing events. Studies in S. pombe have identified various types of alternative splicing during meiosis, including intron retention, novel splicing sites, and exon skipping .

A comprehensive approach would include comparison of SPCC622.07 expression patterns with known membrane proteins or proteins with similar temporal expression profiles, potentially revealing functional associations through guilt-by-association approaches.

What are effective approaches for studying membrane protein topology and structure for proteins like SPCC622.07?

Membrane proteins like SPCC622.07 present unique challenges for structural characterization due to their hydrophobic nature. The following methodological approaches are recommended:

  • Computational prediction methods:

    • Transmembrane domain prediction using algorithms such as TMHMM, Phobius, or MEMSAT

    • Secondary structure prediction using JPred or PSIPRED

    • 3D structure modeling using AlphaFold2 or RoseTTAFold, particularly valuable for uncharacterized proteins

  • Experimental topology mapping:

    • Cysteine scanning mutagenesis with membrane-impermeable reagents

    • Epitope insertion followed by immunofluorescence in semi-permeabilized cells

    • Fusion protein approaches using reporters such as GFP or alkaline phosphatase

  • Structural biology techniques:

    • X-ray crystallography (challenging for membrane proteins but possibly with fusion partners)

    • Cryo-electron microscopy (cryo-EM), which has revolutionized membrane protein structure determination

    • NMR spectroscopy for dynamic regions or smaller membrane proteins

  • Protein stability analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Differential scanning calorimetry (DSC) to measure thermal stability

    • Limited proteolysis to identify structured domains

When working with the recombinant form of SPCC622.07, researchers should consider using detergents or lipid nanodiscs to maintain the native-like membrane environment during structural studies. The relatively small size of SPCC622.07 (128 amino acids) may make it amenable to NMR-based approaches when suitable isotope labeling strategies are employed.

How can researchers investigate protein-protein interactions of SPCC622.07?

Investigating the protein-protein interactions of SPCC622.07 is crucial for understanding its functional role. The following methodological approaches are recommended:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Expression of tagged SPCC622.07 (His-tag has been successfully used )

    • Gentle solubilization using appropriate detergents for membrane proteins

    • Co-immunoprecipitation followed by mass spectrometry to identify interacting partners

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) can be incorporated for quantitative analysis

  • Proximity-based labeling methods:

    • BioID or TurboID fusion proteins to biotinylate proximal proteins

    • APEX2-based proximity labeling for temporal control of labeling

    • These methods are particularly valuable for membrane proteins as they capture transient interactions

  • Yeast two-hybrid adaptations:

    • Split-ubiquitin membrane yeast two-hybrid (MYTH) system specifically designed for membrane proteins

    • Systematic screening against S. pombe ORFeome libraries

  • In vivo cross-linking:

    • Formaldehyde or photoactivatable cross-linkers to capture interactions

    • Cross-linked protein complex immunoprecipitation (X-IP)

  • Fluorescence-based interaction assays:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • Fluorescence Correlation Spectroscopy (FCS)

Potential interaction partners should be validated using reciprocal pull-downs, co-localization studies, or functional assays. Recent research has identified novel protein complexes in S. pombe, such as the Clr6 HDAC complex I″, which includes previously uncharacterized proteins . Similar approaches could reveal functional complexes involving SPCC622.07.

How can researchers integrate multi-omics data to understand SPCC622.07 function?

Understanding the function of uncharacterized proteins like SPCC622.07 benefits greatly from integrating multiple types of omics data. The following methodological framework is recommended:

  • Data types to integrate:

    • Transcriptomics: RNA-seq data to examine expression patterns and co-expression networks

    • Proteomics: MS-based proteomics to identify protein abundance and post-translational modifications

    • Interactomics: Protein-protein interaction data from AP-MS or proximity labeling

    • Phenomics: Systematic phenotyping of deletion/mutation strains

    • Metabolomics: Changes in metabolite profiles associated with SPCC622.07 perturbation

  • Integration strategies:

    • Co-expression network analysis to identify functionally related gene clusters

    • Protein-protein interaction networks to place SPCC622.07 in a cellular context

    • Machine learning approaches to predict function from multiple data types

    • Pathway enrichment analysis across different data types

  • Temporal integration:

    • Analysis of expression dynamics during different cellular processes (e.g., meiosis)

    • Collection of samples at multiple time points (e.g., 0-10 hours at 2-hour intervals)

    • Use of tools like MFUZZanalysis() for temporal clustering of gene expression profiles

  • Comparative genomics:

    • Cross-species comparison to identify conserved features

    • Analysis of synteny and gene neighborhood

    • Evolutionary rate analysis to infer functional constraints

Integration of these diverse data types can provide complementary evidence for functional hypotheses and place SPCC622.07 in the broader context of cellular processes in S. pombe.

What statistical approaches are recommended for analyzing experimental data on SPCC622.07?

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization strategies to minimize bias

    • Inclusion of appropriate controls

    • Multiple biological replicates (typically 3 or more)

  • Differential expression analysis:

    • DESeq2 for RNA-seq data analysis, which provides methods for testing differential expression while accounting for biological variability

    • Statistical models that incorporate time as a factor for temporal studies

  • Multivariate analysis:

    • Principal Component Analysis (PCA) for dimensionality reduction and visualization of complex datasets

    • Hierarchical clustering (HCPCanalysis) for identifying patterns in expression data

    • Fuzzy clustering (MFUZZanalysis) specifically for temporal expression data

  • Quality control metrics:

    • Assessment of outliers using statistical tests

    • Visualization of data distribution to check assumptions

    • Normalization procedures appropriate to the data type

  • Validation approaches:

    • Independent experimental validation of key findings

    • Use of different methodological approaches to confirm results

    • Comparison with published datasets when available

How does SPCC622.07 relate to other membrane proteins in S. pombe?

Contextualizing SPCC622.07 within the landscape of S. pombe membrane proteins provides valuable insights into its potential functions. While specific information about SPCC622.07's relationships is limited, methodological approaches to establish these connections include:

  • Comparative sequence analysis:

    • Identification of shared domains or motifs with characterized membrane proteins

    • Phylogenetic analysis to identify paralogs or proteins with shared evolutionary history

    • Transmembrane topology prediction comparison with functionally characterized membrane proteins

  • Co-expression analysis:

    • Identification of genes with similar expression patterns during cell cycle, meiosis, or stress responses

    • Temporal clustering of expression data to identify functionally related gene groups

    • Analysis of coordinated expression under specific conditions

  • Protein complexes and functional modules:

    • Investigation of potential incorporation into known membrane protein complexes

    • Comparison with other uncharacterized membrane proteins that have been functionally annotated, such as those identified in the Clr6 HDAC complex I″ (e.g., Nts1, Mug165, and Png3)

  • Localization patterns:

    • Systematic comparison of subcellular localization with other membrane proteins

    • Co-localization studies with markers of specific membrane compartments

Understanding these relationships can provide context for functional hypotheses and guide experimental design for further characterization of SPCC622.07.

What role might SPCC622.07 play in cellular processes based on current knowledge?

While SPCC622.07 remains largely uncharacterized, informed hypotheses about its potential roles can be formulated based on available data and comparative analysis:

  • Potential involvement in meiosis:

    • S. pombe undergoes dynamic gene expression changes during meiosis, with many uncharacterized proteins showing stage-specific expression patterns

    • Temporal analysis during meiosis (0-10 hours at 2-hour intervals) could reveal specific stages where SPCC622.07 is upregulated or downregulated

  • Membrane integrity or transport:

    • As a putative membrane protein, SPCC622.07 might participate in maintaining membrane integrity, particularly during cellular processes that involve membrane remodeling

    • Potential roles in ion transport, nutrient uptake, or signal transduction across the membrane

  • Stress response mechanisms:

    • Many membrane proteins in yeast play critical roles in responding to environmental stresses

    • Analysis of expression changes under various stress conditions could provide functional insights

  • Cell cycle regulation:

    • S. pombe is a model organism for cell cycle studies, and membrane proteins often play important roles in cell division and growth

    • Comparison with the 50 S. pombe genes that show similarity to human disease genes (particularly the cancer-related ones) could be informative

Experimental approaches such as gene deletion/mutation followed by phenotypic analysis under various conditions would be essential to test these hypotheses.

How can researchers resolve contradictory experimental data regarding SPCC622.07?

When faced with contradictory experimental data regarding SPCC622.07 or similar uncharacterized proteins, researchers should employ systematic approaches to resolve discrepancies:

  • Methodological evaluation:

    • Critical assessment of experimental methods used in contradictory studies

    • Identification of differences in experimental conditions, strains, or reagents

    • Replication of experiments with standardized protocols and multiple controls

  • Integrated data analysis:

    • Implementation of meta-analysis approaches when multiple datasets are available

    • Weighting of evidence based on methodological rigor and reproducibility

    • Integration of diverse data types to provide a more comprehensive view

  • Resolution strategies:

    • Direct comparison experiments under identical conditions

    • Use of alternative, complementary methods to address the same question

    • Collaboration with laboratories reporting contradictory results

  • Cellular context considerations:

    • Examination of cell-type or condition-specific effects that might explain discrepancies

    • Investigation of potential post-translational modifications or alternative isoforms

    • Analysis of protein complex formation under different conditions

  • Temporal aspects:

    • Careful time-course experiments to detect transient effects or dynamic changes

    • Consideration of circadian or cell-cycle dependent variations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.