Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein P8B7.13 (SPBP8B7.13)

What is the structural characterization of Schizosaccharomyces pombe Putative uncharacterized membrane protein P8B7.13?

The Schizosaccharomyces pombe Putative uncharacterized membrane protein P8B7.13 (SPBP8B7.13) is a 251 amino acid protein with UniProt accession number O94262. The full amino acid sequence is: MSEPKPMQMSVETETVLNVSQVQIPSSCDRKASLETLKTKKNAQKKKKISLPNVMTSKAAMFAARVASA VDQDPNDEESENFVYENLIPTNDDELHSPSASIHSFQTYNLPLEMLPTINHVPYYGSAGTNALNGGPLSNSRKLIPKR SAKFSSMVGSSDTRCNSPTTARGLATSPLQINPTTSKSPLLN KKLSSTSQEPFRTSRRSGQESGDVTTKMLRNLLHKRLWISFFF ACFVVLSLVYFHYAVQPLL . Structural analysis suggests it contains transmembrane domains consistent with its classification as a membrane protein, though detailed structural studies using crystallography or cryo-EM have not yet been reported in the literature.

How does the expression of SPBP8B7.13 compare across different growth conditions in S. pombe?

Expression analysis of SPBP8B7.13 shows variable patterns across different growth conditions. While comprehensive expression profiles aren't fully established, general methodologies for studying S. pombe protein expression can be applied. Researchers typically employ quantitative PCR and RNA-seq to measure transcript levels, alongside western blotting with specific antibodies to detect protein levels. Integration of heterogeneous genomic data from large collections (approximately 30 billion data points for human systems) has proven valuable in understanding context-specific gene expression . For S. pombe, similar approaches can reveal how SPBP8B7.13 expression changes during different growth phases, nutrient conditions, or stress responses. Preliminary data suggests expression may be regulated during cell cycle progression, though this requires further experimental validation.

What are the most effective methods for producing Recombinant SPBP8B7.13 protein for experimental studies?

Recombinant SPBP8B7.13 protein can be effectively produced using bacterial or yeast expression systems. The protein is typically expressed with a tag to facilitate purification, with the tag type determined during the production process to optimize protein stability and functionality . For membrane proteins like SPBP8B7.13, E. coli systems using specialized strains (C41, C43) designed for membrane protein expression often yield good results. Alternatively, eukaryotic expression systems like Pichia pastoris may provide better folding environments for complex membrane proteins.

The purified protein is generally stored in Tris-based buffer with 50% glycerol to maintain stability . Researchers should implement quality control measures including SDS-PAGE, mass spectrometry, and circular dichroism to verify protein integrity before experimental use. Repeated freeze-thaw cycles should be avoided, with working aliquots maintained at 4°C for up to one week to preserve biological activity .

How might SPBP8B7.13 interact with protein kinase C homologues in S. pombe signaling pathways?

The potential interaction between SPBP8B7.13 and protein kinase C homologues in S. pombe represents an intriguing research direction. S. pombe has two protein kinase C homologues, pck1p and pck2p, that interact with GTP-bound forms of rho1p and rho2p GTPases . These interactions involve the amino-terminal regions of the PCKs where two HR1 motifs are located, and binding to the GTPases significantly stabilizes the kinases .

A methodological approach to investigate SPBP8B7.13's potential involvement would include:

• Co-immunoprecipitation assays with tagged versions of SPBP8B7.13 and PCK proteins

• Yeast two-hybrid screening to detect direct protein-protein interactions

• Bimolecular fluorescence complementation to visualize interactions in vivo

• Phosphoproteomic analysis to determine if SPBP8B7.13 is phosphorylated by PCKs

Given that pck2p plays a more significant role in cell wall biosynthesis regulation and (1-3)β-D-glucan synthase activity , researchers should particularly focus on potential connections between SPBP8B7.13 and this signaling pathway. If SPBP8B7.13 is found to interact with these kinases, it might contribute to cell integrity maintenance or polarized growth processes in S. pombe.

What role might SPBP8B7.13 play in mating-type switching mechanisms in S. pombe?

S. pombe undergoes programmed gene conversion events during mating-type switching, regulated by DNA replication, heterochromatin, and proteins like the HP1-like chromodomain protein Swi6 . While SPBP8B7.13 has not been directly implicated in this process, investigating its potential role requires sophisticated experimental approaches.

Researchers exploring this question should consider:

• Creating SPBP8B7.13 deletion strains and assessing their mating-type switching efficiency

• Examining the localization of fluorescently tagged SPBP8B7.13 during different stages of the cell cycle

• Performing chromatin immunoprecipitation to determine if SPBP8B7.13 associates with relevant genomic loci

• Exploring genetic interactions between SPBP8B7.13 and known mating-type switching factors

Recent studies have identified multiple factors required for donor selection in mating-type switching, including components of the histone H3 lysine 4 (H3K4) methyltransferase complex, the BRE1-like ubiquitin ligase Brl2, and the Elongator complex . If SPBP8B7.13 functions in membrane-nuclear signaling or chromatin organization, it might influence these processes, opening new research paths in understanding the complex mechanisms of mating-type switching in fission yeast.

How could spatial genomics approaches enhance our understanding of SPBP8B7.13 function in cellular contexts?

Spatial genomics methodologies offer powerful approaches for understanding the function of SPBP8B7.13 in its cellular context. These techniques enable researchers to visualize gene expression patterns while preserving spatial information about cellular organization. Optimizing experimental design for spatial genomics studies involves selecting appropriate cross-sections of tissue that will yield maximally informative experiments when profiled with spatial genomics assays .

For studying SPBP8B7.13 in S. pombe, researchers could employ:

• Single-molecule FISH to visualize the spatial distribution of SPBP8B7.13 mRNA

• Proximity labeling techniques (BioID, APEX) to identify proteins in close spatial proximity to SPBP8B7.13

• Correlative light and electron microscopy to precisely localize the protein within membrane structures

When designing these experiments, five methodological approaches should be considered:

The Bayesian optimal experimental design framework can guide these studies by finding the experimental conditions expected to provide maximum information about SPBP8B7.13's spatial distribution and functional interactions .

What controls should be included when assessing SPBP8B7.13 function through gene deletion or mutation?

When designing experiments to assess SPBP8B7.13 function through gene deletion or mutation, several essential controls must be included to ensure reliable and interpretable results:

• Wild-type control: Include the parental strain without any modifications to establish baseline phenotypes.

• Empty vector control: For complementation studies, include cells transformed with the empty expression vector.

• Rescue control: Re-express the wild-type SPBP8B7.13 in the deletion strain to confirm phenotypes are due to the absence of the target gene.

• Domain mutant controls: Generate point mutations or domain deletions to identify critical functional regions.

• Tagged protein controls: Verify that any epitope tags don't interfere with protein function.

When analyzing phenotypes resulting from SPBP8B7.13 deletion, researchers should examine:

• Growth rates under various conditions (temperature, nutrients, stress)

• Cell morphology and size distribution

• Cell wall integrity (using dyes like calcofluor white)

• Membrane organization and dynamics

• Protein localization patterns of known interacting partners

These assessments should be quantitative whenever possible, with statistical analysis of multiple independent experiments to ensure reproducibility. Integration of heterogeneous genomic data designed specifically for large data collections can further strengthen functional predictions about SPBP8B7.13 .

How should researchers design experiments to investigate potential interactions between SPBP8B7.13 and the cell wall integrity pathway?

The cell wall integrity pathway in S. pombe involves the protein kinase C homologues pck1p and pck2p, which interact with rho1p and rho2p GTPases . To investigate SPBP8B7.13's potential role in this pathway, a comprehensive experimental design should include:

• Epistasis analysis: Create double mutants between SPBP8B7.13 and components of the cell wall integrity pathway (pck1Δ, pck2Δ, rho1 mutants, rho2Δ) to determine genetic relationships.

• Phenotypic analysis: Compare cell wall defects in single and double mutants using:

  • Sensitivity to cell wall-disrupting agents (calcofluor white, Congo red)

  • Electron microscopy to visualize cell wall ultrastructure

  • Enzymatic analysis of cell wall composition

• Biochemical interaction studies:

  • Co-immunoprecipitation of SPBP8B7.13 with pathway components

  • In vitro binding assays with purified proteins

  • FRET or BiFC analysis for in vivo interaction detection

• Activity assays: Measure (1-3)β-D-glucan synthase activity in membrane fractions from wild-type and SPBP8B7.13 mutant cells, as this enzyme is a key effector of the pathway .

Given that pck2p overexpression causes increased cell wall biosynthesis and (1-3)β-D-glucan synthase activity , researchers should particularly examine whether SPBP8B7.13 influences these pck2p-mediated effects, potentially by serving as a membrane anchor or regulator of the pathway.

What experimental approaches would best reveal the molecular function of SPBP8B7.13 in membrane organization?

As a putative membrane protein, SPBP8B7.13 likely contributes to membrane organization or transport processes. The following experimental approaches would effectively elucidate its molecular function:

• Subcellular localization studies:

  • Fluorescence microscopy with GFP-tagged SPBP8B7.13

  • Immunogold electron microscopy for precise membrane localization

  • Co-localization with known membrane compartment markers

• Membrane topology analysis:

  • Protease protection assays to determine cytoplasmic vs. luminal domains

  • Glycosylation mapping to identify luminal segments

  • FRET-based proximity analysis with reference proteins

• Lipid interaction studies:

  • Lipidomic analysis comparing wild-type and SPBP8B7.13Δ cells

  • Lipid binding assays with purified protein

  • Effects of specific lipid depletion on SPBP8B7.13 localization

• Functional transport assays:

  • Membrane potential measurements

  • Ion flux studies

  • Vesicular transport tracking

These approaches should be combined with complementary genetic screens to identify synthetic lethal or suppressor interactions, which can place SPBP8B7.13 within specific membrane-related pathways. Additionally, large-scale genomic data integration methods can provide contextual information about the protein's function by analyzing co-expression patterns across diverse conditions .

How should researchers interpret conflicting data about SPBP8B7.13 function from different experimental approaches?

When facing conflicting data about SPBP8B7.13 function from different experimental approaches, researchers should employ a systematic framework for data reconciliation:

• Evaluate methodological differences:

  • Assess the strengths and limitations of each experimental approach

  • Consider differences in strain backgrounds, growth conditions, and assay sensitivities

  • Determine whether conflicts arise from technical or biological variability

• Perform integrative analysis:

  • Develop computational models that incorporate data from multiple sources

  • Use Bayesian approaches to weigh evidence based on methodological reliability

  • Apply methods designed specifically for integrating heterogeneous genomic data

• Design decisive experiments:

  • Identify critical tests that can distinguish between competing hypotheses

  • Employ orthogonal approaches to validate key findings

  • Consider experimental design optimization techniques like those used in spatial genomics studies

• Context-dependent interpretation:

  • Recognize that SPBP8B7.13 may have different functions under different conditions

  • Consider potential post-translational modifications affecting protein function

  • Evaluate whether protein complexes vary across experimental conditions

This structured approach helps researchers develop a coherent model of SPBP8B7.13 function that accommodates seemingly conflicting observations and identifies conditions under which specific functions predominate.

What statistical approaches are most appropriate for analyzing SPBP8B7.13 localization and interaction data?

• For protein localization analysis:

  • Pearson's correlation coefficient for co-localization quantification

  • Manders' overlap coefficient for partial co-localization assessment

  • Object-based approaches for discrete structures

  • Spatial statistics for clustering analysis

• For protein-protein interaction data:

  • Permutation tests to establish significance of co-immunoprecipitation results

  • Likelihood ratio tests for comparing interaction models

  • SAINT (Significance Analysis of INTeractome) for high-confidence interaction networks

  • Bayesian networks for inferring direct vs. indirect interactions

• For omics data integration:

  • Principal component analysis to identify major sources of variation

  • Partial least squares discrimination analysis for multivariate relationships

  • Machine learning approaches for pattern recognition across datasets

  • Network-based methods that leverage the statistical power of large data collections

• For experimental design optimization:

  • Expected information gain (EIG) calculations to identify maximally informative experiments

  • Power analysis to determine appropriate sample sizes

  • Multiple testing correction for high-throughput screens

  • Bootstrapping approaches for confidence interval estimation

These statistical frameworks should be implemented within a larger computational pipeline that facilitates reproducible analysis and transparent reporting of results, enabling other researchers to validate and build upon the findings.

How can researchers distinguish between direct and indirect effects when studying SPBP8B7.13 influence on cellular pathways?

Distinguishing between direct and indirect effects of SPBP8B7.13 on cellular pathways presents a significant challenge requiring methodological rigor:

• Temporal resolution approaches:

  • Time-course experiments with high temporal resolution

  • Inducible expression systems for rapid protein deployment

  • Degron-based systems for acute protein depletion

  • Kinetic modeling to infer causality from temporal sequences

• Proximity-based methods:

  • BioID or APEX2 proximity labeling to identify proteins in close physical association

  • Crosslinking mass spectrometry to capture direct binding partners

  • FRET-based sensors to detect direct molecular interactions in real-time

  • Split-protein complementation assays for direct binding validation

• Domain-specific perturbations:

  • Structure-guided mutagenesis targeting specific functional domains

  • Chimeric protein construction to isolate functional modules

  • Domain-swapping experiments to test sufficiency for pathway effects

  • Competitive inhibition with isolated domains or peptide mimetics

• Systems biology approaches:

  • Network perturbation analysis to trace information flow through pathways

  • Epistasis miniarray profiles to position genes within pathways

  • Integration of multiple data types including transcriptomics, proteomics, and metabolomics

  • Mathematical modeling incorporating known biochemical constraints

When applying these approaches to study SPBP8B7.13's role in cell wall integrity pathways, researchers should particularly focus on its potential direct interactions with protein kinase C homologues (pck1p and pck2p) or their effectors , while considering the complex regulatory networks that maintain cell integrity in S. pombe.

What emerging technologies could advance our understanding of SPBP8B7.13 function in S. pombe biology?

Several cutting-edge technologies offer promising avenues for deepening our understanding of SPBP8B7.13 function:

• CRISPR-based technologies:

  • Base editing for precise amino acid substitutions without double-strand breaks

  • CRISPRi for conditional and partial repression of SPBP8B7.13 expression

  • CRISPR activation systems to study effects of upregulation

  • CRISPR screens to identify genetic interactions systematically

• Advanced imaging approaches:

  • Super-resolution microscopy (STORM, PALM) to visualize nanoscale protein organization

  • Lattice light-sheet microscopy for long-term 3D imaging with reduced phototoxicity

  • Cryo-electron tomography to visualize SPBP8B7.13 in its native membrane environment

  • Spatial transcriptomics techniques optimized using Bayesian experimental design principles

• Single-cell multi-omics:

  • Integrated single-cell transcriptomics and proteomics

  • Single-cell metabolic profiling

  • Spatial single-cell analysis to preserve contextual information

  • Trajectory inference to map dynamic processes

• Computational approaches:

  • AlphaFold2 or RoseTTAFold for structure prediction

  • Molecular dynamics simulations of membrane protein behavior

  • Network-based integration of large-scale heterogeneous genomic data

  • Machine learning for phenotypic analysis and function prediction

These technologies, especially when combined in integrated experimental pipelines, have the potential to resolve currently unanswered questions about SPBP8B7.13's structural configuration, interaction partners, and functional roles in S. pombe cellular processes.

How might comparative analysis across yeast species inform SPBP8B7.13 functional studies?

Comparative analysis across yeast species represents a powerful approach for understanding SPBP8B7.13 function through evolutionary context:

• Homology-based approaches:

  • Identification of SPBP8B7.13 homologs in related species through sequence similarity searches

  • Phylogenetic analysis to trace evolutionary relationships and potential functional divergence

  • Domain conservation analysis to identify critical functional elements

  • Synteny analysis to examine genomic context conservation

• Functional complementation studies:

  • Expression of SPBP8B7.13 in other yeast species with mutations in potential orthologous genes

  • Heterologous expression of related proteins from other species in S. pombe SPBP8B7.13Δ strains

  • Analysis of cross-species protein-protein interactions

• Comparative systems biology:

  • Network comparison across species to identify conserved functional modules

  • Cross-species expression analysis to identify conserved regulatory patterns

  • Metabolic modeling to compare pathway dependencies

• Comparative response to perturbations:

  • Analysis of phenotypic effects of ortholog deletion across species

  • Comparative chemical genomics profiling

  • Cross-species stress response patterns

This evolutionary perspective can provide crucial insights, particularly when considering potential relationships to better-characterized proteins in model organisms like Saccharomyces cerevisiae. For instance, understanding how SPBP8B7.13 relates to proteins involved in cell wall integrity pathways across different yeast species could illuminate its function, given the established roles of protein kinase C homologues in these processes .