Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein PB15E9.02c (SPAPB15E9.02c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAPB15E9.02c; Putative uncharacterized membrane protein PB15E9.02c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAPB15E9.02c
Target Protein Sequence
MTGMFFFASLFSSFESLFFRLFFVCSFFFPLLYSFIFATLHAFVFLFSHTLVSSQFRRLK LPYHHHHTFTIEAFFYWFFFFFFFFSHCRRFHIAIFIHPYDSNVVPFFCFFFYFSLFSFF SFLFTSLHFNFFFRLCRHKHLLDIPDQTTLSSLLHRHTRLPRDVRRKHTCFHTSVWCDMS SYCIAWRS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic and protein information for SPAPB15E9.02c?

SPAPB15E9.02c is a protein-coding gene in Schizosaccharomyces pombe (fission yeast) with the following characteristics:

Gene SymbolSPAPB15E9.02c
Entrez Gene ID3361426
Full NameHypothetical protein
Gene TypeProtein-coding
OrganismSchizosaccharomyces pombe (fission yeast)
mRNANM_001019830.2
ProteinNP_001018275.1

The gene was identified as part of the comprehensive S. pombe genome sequencing project led by Wood et al., which characterized the full genome of this model organism . As a hypothetical protein, its function remains to be experimentally determined.

What experimental approaches are recommended for initial characterization of SPAPB15E9.02c?

Initial characterization of an uncharacterized protein such as SPAPB15E9.02c should follow a systematic approach:

  • Sequence analysis: Perform bioinformatic analysis including homology searches, domain prediction, and structural modeling.

  • Expression profiling: Analyze expression patterns across different conditions using techniques similar to those employed in S. pombe acetyltransferase mutant studies .

  • Subcellular localization: Generate GFP-tagged versions of the protein to determine its localization, similar to approaches used for Mug28 protein localization studies in S. pombe .

  • Gene deletion: Create knockout strains using the pClone vector system, which has been successfully used in the S. pombe genome deletion project for targeting genes that were initially difficult to delete .

  • Phenotypic analysis: Assess the impact of gene deletion on growth, morphology, and responses to various stresses, using systematic approaches similar to those employed in fission yeast lifespan studies .

How should I approach gene knockout experiments for SPAPB15E9.02c?

For generating SPAPB15E9.02c knockout strains, consider the following methodological approach:

  • Vector selection: Use specialized vectors such as pCloneNat1, pCloneHyg1, pCloneKan1, or pCloneBle1, which contain dominant drug resistance markers that confer resistance to nourseothricin, hygromycin B, geneticin, and phleomycin, respectively .

  • Homology requirements: Since SPAPB15E9.02c may be difficult to delete with standard approaches, employ the technique developed by Gregan et al. that uses knockout constructs containing large regions homologous to the target gene .

  • Verification strategy: Confirm successful deletion using both PCR-based methods and phenotypic confirmation with appropriate selection markers.

  • Heterozygous diploid approach: If SPAPB15E9.02c is essential, create heterozygous diploid strains first, following methods established by the S. pombe genome deletion project .

What are the best approaches for studying protein-protein interactions of SPAPB15E9.02c?

To identify potential interaction partners of SPAPB15E9.02c, consider these methodological approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express epitope-tagged SPAPB15E9.02c (e.g., TAP-tag, FLAG-tag) in S. pombe

    • Perform affinity purification under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions using reciprocal tagging and co-immunoprecipitation

  • Yeast two-hybrid screening:

    • Use SPAPB15E9.02c as a bait protein

    • Screen against an S. pombe cDNA library

    • Verify positive interactions through secondary screens

    • Confirm interactions in vivo using co-localization studies

  • Proximity-based labeling methods:

    • Fuse SPAPB15E9.02c to BioID or TurboID enzymes

    • Identify proteins in spatial proximity through biotinylation

    • Analyze biotinylated proteins by streptavidin pulldown and mass spectrometry

The experimental design should include appropriate controls and validation strategies to distinguish true interactions from false positives.

How can I analyze the expression profile of SPAPB15E9.02c across different conditions?

Expression profiling of SPAPB15E9.02c requires a comprehensive experimental approach:

  • RNA-seq analysis:

    • Culture S. pombe under various conditions (different growth phases, stresses, nutrient limitations)

    • Extract total RNA and perform RNA-seq

    • Compare SPAPB15E9.02c expression levels across conditions

    • Analyze co-expressed genes to identify potential functional relationships

  • Quantitative RT-PCR validation:

    • Design primers specific to SPAPB15E9.02c

    • Perform qRT-PCR across conditions of interest

    • Normalize expression using appropriate reference genes

  • Promoter analysis:

    • Clone the SPAPB15E9.02c promoter region upstream of a reporter gene

    • Measure reporter activity under different conditions

    • Identify regulatory elements through deletion analysis

Analysis of expression data should follow established statistical methods such as those described in the evidence-based statistical analysis and methods in biomedical research (SAMBR) checklists .

How should I interpret phenotypic data from SPAPB15E9.02c deletion strains?

Phenotypic characterization of SPAPB15E9.02c deletion strains requires systematic analysis:

Phenotypic AssayMethodologyData Analysis Approach
Growth curve analysisCulture cells in different media/conditions and measure OD600 at regular intervalsCalculate growth rate and lag phase; compare with wild-type using appropriate statistical tests
Stress response assaysExpose cells to various stressors (oxidative, heat, osmotic, DNA damage) and assess survivalQuantify survival rates and present as percentage of control; analyze using ANOVA or similar tests
Microscopic analysisExamine cell morphology, size, and division patterns using phase contrast and fluorescence microscopyMeasure cell dimensions and quantify morphological abnormalities using image analysis software
Lifespan analysisPerform chronological lifespan assays using methods similar to those described for S. pombe lifespan studiesGenerate survival curves and calculate area under the curve (AUC) as described in S. pombe lifespan research

When interpreting results:

  • Compare phenotypes with well-characterized S. pombe mutants

  • Consider potential compensatory mechanisms that might mask phenotypes

  • Assess phenotypes under multiple conditions to reveal condition-specific defects

  • Perform complementation tests to confirm that phenotypes are directly due to SPAPB15E9.02c deletion

  • Generate double mutants with functionally related genes to identify genetic interactions

What approaches should I use to study the potential membrane localization of SPAPB15E9.02c?

As a putative membrane protein, SPAPB15E9.02c requires specialized approaches for localization studies:

  • GFP fusion constructs:

    • Create both N-terminal and C-terminal GFP fusions

    • Express from native promoter to maintain physiological expression levels

    • Use live cell imaging to visualize localization patterns

    • Co-localize with established membrane markers

  • Membrane fractionation:

    • Perform subcellular fractionation to isolate different membrane compartments

    • Analyze protein distribution by western blotting

    • Use established membrane markers as controls

  • Immunoelectron microscopy:

    • Generate specific antibodies or use epitope tags

    • Perform immunogold labeling

    • Analyze at ultrastructural level to determine precise membrane localization

  • Protease protection assays:

    • Determine protein topology through limited proteolysis of intact cells or isolated membranes

    • Analyze protected fragments to map membrane-spanning regions

The approach used for visualizing the forespore membrane (FSM) using GFP-tagged Psy1 in Mug28 studies provides a methodological template that can be adapted for SPAPB15E9.02c localization studies .

How should I present and analyze data from SPAPB15E9.02c research?

Effective presentation of research data requires careful consideration of data types and appropriate visualization methods:

  • Table design principles:

    • Use tables to organize, analyze, and display evidence in a succinct and convincing way

    • Consider using data inventory tables, data sources tables, event listings, cross-case analysis tables, and theoretical summaries depending on your data type

    • Follow the guidelines provided in the "Using tables to enhance trustworthiness in qualitative research" framework

  • Statistical analysis approaches:

    • Apply appropriate statistical methods based on your research design following SAMBR checklists

    • For expression data analysis, use methods similar to those employed in S. pombe acetyltransferase mutant studies

    • When analyzing survival or lifespan data, employ both trapezoid and spline methods to calculate area under the curve (AUC) as used in S. pombe lifespan studies

  • Data visualization strategies:

    • Present correlations using scatterplots with correlation coefficients and significance levels

    • Use heatmaps for gene expression comparisons across multiple conditions

    • Employ network diagrams for protein interaction data

How can I integrate multiple experimental approaches to determine the function of SPAPB15E9.02c?

Functional characterization of uncharacterized proteins like SPAPB15E9.02c requires integration of multiple approaches:

  • Multi-omics integration strategy:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use network analysis to identify functional relationships

    • Apply machine learning approaches to predict function from integrated datasets

  • Comparative analysis framework:

    • Compare phenotypes with other S. pombe membrane protein mutants

    • Analyze evolutionary conservation across fungal species

    • Examine functional data from homologs in other organisms

  • Genetic interaction mapping:

    • Perform systematic genetic interaction screens

    • Generate double mutants with genes in related pathways

    • Use synthetic genetic array (SGA) methodology adapted for S. pombe

  • Function validation experiments:

    • Design rescue experiments with wildtype and mutant versions

    • Perform domain deletion/mutation analysis

    • Assess function through targeted assays based on predicted functions

When faced with contradictory results, apply the following analytical framework:

  • Evaluate the strengths and limitations of each experimental approach

  • Consider context-dependency of the observations

  • Design controlled experiments to specifically address contradictions

  • Use orthogonal approaches to validate key findings

What experimental design considerations are important when studying SPAPB15E9.02c during meiosis?

Studying SPAPB15E9.02c during meiosis requires special experimental design considerations:

  • Synchronization methods:

    • Use temperature-sensitive pat1 mutants for synchronized meiotic induction

    • Monitor meiotic progression using DAPI staining of nuclei

    • Track SPB behavior using Sad1-mCherry as a marker, similar to methods used in Mug28 studies

  • Meiosis-specific phenotypic assays:

    • Assess spore formation and viability

    • Examine forespore membrane formation using fluorescence microscopy

    • Analyze meiotic chromosome segregation

  • Expression profiling during meiosis:

    • Perform time-course analysis throughout meiotic progression

    • Compare expression patterns with known meiosis-specific genes

    • Consider using techniques similar to those that identified meiosis-upregulated genes like mug28+

  • Experimental controls:

    • Include known meiosis-specific proteins as positive controls

    • Compare with characterized membrane proteins that function during meiosis

    • Use appropriate statistical methods for time-course data analysis

How should I approach contradictions between different datasets when studying SPAPB15E9.02c?

Resolving contradictions in research data requires systematic investigation:

  • Identify the source of contradictions:

    • Examine differences in experimental conditions

    • Consider strain background variations

    • Evaluate methodological differences between studies

  • Design reconciliation experiments:

    • Perform side-by-side comparisons under identical conditions

    • Use multiple methodologies to address the same question

    • Develop controlled experiments specifically targeting contradictory results

  • Statistical approaches:

    • Apply meta-analysis techniques to integrate contradictory findings

    • Perform sensitivity analyses to identify condition-dependent effects

    • Use Bayesian approaches to update probability estimates as new evidence emerges

  • Reporting contradictions:

    • Present contradictory results transparently in publications

    • Discuss possible explanations for the contradictions

    • Propose future experiments to resolve remaining questions

Remember that contradictions often lead to new insights about context-dependent functions or reveal previously unknown regulatory mechanisms.

What novel approaches could advance our understanding of SPAPB15E9.02c function?

Several cutting-edge approaches could significantly advance understanding of SPAPB15E9.02c:

  • CRISPR-based techniques:

    • Implement CRISPR interference (CRISPRi) for conditional repression

    • Use CRISPR activation (CRISPRa) to upregulate expression

    • Apply base editing for precise mutagenesis without double-strand breaks

  • Single-cell approaches:

    • Perform single-cell RNA-seq to detect cell-to-cell variation in expression

    • Use single-cell proteomics to assess protein abundance at individual cell level

    • Implement microfluidics-based single-cell phenotyping

  • Structural biology methods:

    • Apply cryo-electron microscopy for membrane protein structure determination

    • Use integrative structural biology combining multiple experimental data types

    • Implement AlphaFold2 and related AI approaches for structure prediction and validation

  • Systems biology integration:

    • Develop mathematical models of pathways involving SPAPB15E9.02c

    • Use machine learning to predict functions from multi-omics data

    • Implement network analysis to position SPAPB15E9.02c in cellular interaction networks

These approaches will require careful experimental design and appropriate controls, but have the potential to provide unprecedented insights into the function of this uncharacterized protein.

How can I leverage Google's People Also Ask data to guide my research on SPAPB15E9.02c?

The People Also Ask (PAA) feature from Google search can be a valuable tool for identifying research gaps and common questions about SPAPB15E9.02c:

  • Systematic PAA data collection:

    • Perform multiple related searches around SPAPB15E9.02c and S. pombe membrane proteins

    • Click on PAA questions to expand the cascading questions

    • Organize questions by theme and complexity

  • Research gap identification:

    • Analyze patterns in PAA questions to identify areas of scientific interest

    • Compare PAA questions with existing literature to identify unanswered questions

    • Use PAA data to supplement traditional literature review methods

  • Methodological considerations:

    • Recognize that PAA appears in over 80% of English searches, representing common information needs

    • Understand that PAA reveals searcher behavior patterns and topic relationships

    • Use PAA data to understand how complex queries are broken down, which can inform how to structure your research questions

  • Integration with research planning:

    • Use PAA questions as a starting point for developing testable hypotheses

    • Structure research papers to address common questions identified through PAA

    • Consider addressing PAA questions in the discussion section of publications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.