Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C12C2.14c (SPBC12C2.14c)

Shipped with Ice Packs
In Stock

Description

Production and Purification

SPBC12C2.14c is heterologously expressed in Escherichia coli as a recombinant protein fused to an N-terminal His tag for affinity purification (e.g., nickel-chelate chromatography) . Key production parameters include:

ParameterValue
Host OrganismE. coli
TagN-terminal His
Purity>90% (SDS-PAGE validated)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL), with 5–50% glycerol for long-term storage

This recombinant protein is distributed by commercial providers like Creative BioMart and e-scapebio, typically at a concentration of 50 µg per vial .

Research Applications and Potential Uses

While SPBC12C2.14c remains uncharacterized, its recombinant form enables hypothesis-driven studies:

Hypothesized Functional Roles

  1. Gene Function Elucidation:

    • Knockout or RNA interference (RNAi) studies could reveal phenotypic effects, though no such data exists yet.

    • Biochemical assays (e.g., kinase activity, binding assays) may uncover enzymatic or interaction partners.

  2. Protein-Protein Interaction Screens:

    • Pull-down assays using the His-tagged protein could identify interactors in S. pombe or heterologous systems.

    • Cross-species homology studies: No close orthologs are annotated in Saccharomyces cerevisiae or metazoans, limiting comparative insights .

Challenges and Limitations

  1. Functional Anonymity:

    • No interactions or pathways are curated in databases like BioGRID or PomBase .

    • Absence of homologs in model organisms complicates functional prediction.

  2. Experimental Gaps:

    • No published studies using this recombinant protein exist, limiting validation of its utility.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development accordingly.
Synonyms
SPBC12C2.14c; Putative uncharacterized protein C12C2.14c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC12C2.14c
Target Protein Sequence
MEELQYNFKKRRKTHNGISRFQRSALPLTIVYTIWSTFGSPCSGDQRVTLSITSILRKVQ DRRESEKKVKGKGREEYRRYYFFLLFYVSFPHIFLGLFFFIDKKILPFQSV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the basic genomic properties of SPBC12C2.14c?

SPBC12C2.14c is a protein-coding gene in Schizosaccharomyces pombe (fission yeast) with Entrez Gene ID 2539897. The gene encodes a hypothetical protein with an ORF nucleotide sequence length of 336bp. The corresponding mRNA and protein accession numbers are NM_001021927.1 and NP_596019.1, respectively. It's important to note that this is a PROVISIONAL REFSEQ that has not yet been subject to final NCBI review, and it is currently annotated as incomplete on both ends .

When approaching the characterization of uncharacterized proteins, it's advisable to first compile all available sequence data and annotations from multiple databases beyond NCBI, including PomBase (the dedicated S. pombe database), UniProt, and InterPro to identify any potential functional domains or motifs.

How can researchers determine if SPBC12C2.14c might be located in subtelomeric regions?

To determine if SPBC12C2.14c is located in subtelomeric regions, researchers should analyze its chromosomal location and compare it with the known organization of S. pombe chromosomes. S. pombe has three chromosomes (Ch1: 5.6 Mb; Ch2: 4.6 Mb; Ch3: 3.5 Mb) with distinct subtelomeric structures .

Methodologically, this requires:

  • Mapping the gene locus precisely using the complete genome sequence

  • Determining if it falls within the ~100 kb subtelomeric regions, which are subdivided into:

    • Telomere-adjacent regions (SH regions) that share high similarity (>90% identity) with at least one other subtelomere

    • SH-adjacent regions (SU regions) that have unique sequences but condensed chromatin structures

If SPBC12C2.14c is located in subtelomeric regions, researchers should consider the technical challenges of sequence assembly and validation in these regions, possibly requiring specialized techniques like long-read sequencing as used by Tusso et al. for natural isolates of S. pombe .

What computational approaches should be used to predict potential functions of SPBC12C2.14c?

For computationally predicting functions of uncharacterized proteins like SPBC12C2.14c, implement a multi-faceted approach:

  • Sequence homology analysis: Use BLAST, HHpred, and PSI-BLAST against multiple databases to identify distant homologs

  • Domain and motif prediction: Apply InterProScan, PFAM, and PROSITE to identify functional domains

  • Structural prediction: Utilize AlphaFold2 or RoseTTAFold to generate 3D structure predictions

  • Cellular localization prediction: Apply TargetP, PSORT, and DeepLoc for subcellular localization prediction

  • Protein-protein interaction prediction: Use STRING database and interactome analysis

  • Gene neighborhood analysis: Examine synteny and gene cluster conservation across yeast species

What experimental strategy would be most effective for initial characterization of SPBC12C2.14c function?

The most effective initial characterization strategy follows a hierarchical approach:

Experimental LevelTechniquesExpected OutcomesApproximate Timeline
Genetic analysisGene knockout, conditional expressionViability, growth phenotypes2-4 weeks
Protein expressionRecombinant expression with tagsProtein yields, solubility3-6 weeks
LocalizationGFP fusion, immunofluorescenceSubcellular localization2-4 weeks
Interaction studiesCo-IP, BioID, Y2HProtein partners6-8 weeks
Initial functional assaysBased on prediction resultsPreliminary function4-12 weeks

For uncharacterized proteins, it's critical to assign clear roles within the research team. Begin with genetic manipulations to determine if the gene is essential and what phenotypes result from its deletion or overexpression. Simultaneously, express the recombinant protein with appropriate tags for detection and purification. The GFP fusion approach provides valuable localization data, which can help narrow down functional hypotheses2.

How should researchers design experiments to determine if SPBC12C2.14c is expressed during specific cell cycle phases?

To determine cell cycle-specific expression patterns of SPBC12C2.14c, implement the following experimental design:

  • Synchronization methods:

    • Temperature-sensitive cdc mutants (e.g., cdc25-22) for G2/M synchronization

    • Nitrogen starvation and release for G1 synchronization

    • Hydroxyurea treatment for S-phase arrest

  • Expression analysis techniques:

    • Quantitative RT-PCR at 15-minute intervals after synchronization release

    • Northern blotting for mRNA level changes

    • Western blotting with tagged protein versions

    • Single-cell RNA-seq for population heterogeneity analysis

  • Live cell imaging:

    • Time-lapse microscopy with GFP-tagged SPBC12C2.14c

    • Correlation with cell cycle markers (e.g., spindle pole body proteins)

The experimental design should include appropriate controls for synchronization efficiency (e.g., monitoring septation index) and loading controls for expression analysis. When collecting data, establish a standardized timeline relative to cell division events to enable proper comparison across experiments and with published datasets of known cell cycle-regulated genes in S. pombe.

What experimental design would best address the challenge of studying a protein with unknown function like SPBC12C2.14c?

When confronting the challenge of an uncharacterized protein, a systematic phenotypic screening approach is recommended:

  • Primary phenotypic screens:

    • Growth under various stress conditions (temperature, osmotic, oxidative)

    • Cell morphology analysis via microscopy

    • Cell wall integrity assays (calcofluor white, congo red sensitivity)

    • DNA damage response tests (UV, MMS, hydroxyurea sensitivity)

    • Chromosome segregation analysis (DAPI staining, missegregation rates)

  • Secondary screens based on primary hits:

    • Detailed analysis of pathways implicated in primary screens

    • Genetic interaction mapping with known pathway components

    • Synthetic genetic array (SGA) analysis

  • Data integration and hypothesis generation:

    • Correlate phenotypes with cellular processes

    • Design targeted biochemical assays based on phenotypic clusters

    • Test specific molecular functions predicted from phenotypic profiles

This experimental design follows an unbiased approach that allows the protein's function to be revealed through its phenotypic signature. Implement role division in research teams, with dedicated members focusing on phenotypic screens, others on expression/purification, and others on data analysis and integration, as outlined in experimental design approaches for complex scientific investigations2.

What expression system would be optimal for producing recombinant SPBC12C2.14c protein?

The optimal expression system for SPBC12C2.14c should be selected based on several considerations:

Expression SystemAdvantagesDisadvantagesSuitability for SPBC12C2.14c
E. coliFast growth, high yields, inexpensiveMay lack proper folding for eukaryotic proteinsGood initial choice for small proteins (336bp ORF suggests small size)
Yeast systems (S. cerevisiae, P. pastoris)Eukaryotic folding, PTMsLower yields than E. coliExcellent alternative if E. coli fails
S. pombeNative environmentMore complex than E. coliIdeal for functional studies
Insect/BaculovirusAdvanced eukaryotic foldingTime-consuming, expensiveConsider if protein requires complex folding

For initial purification, include a His-tag as described for other recombinant proteins , with careful optimization of lysis conditions (buffer composition, sonication parameters) to ensure maximum soluble protein recovery.

How can researchers optimize the stability of recombinant SPBC12C2.14c protein?

To optimize stability of recombinant SPBC12C2.14c, implement a systematic approach using response surface methodology (RSM) and Central Composite Design (CCD):

  • Buffer screening:
    Test multiple buffer systems (Tris, Phosphate, HEPES) at various pH ranges (6.5-9.0), as demonstrated for other recombinant proteins .

  • Stabilizing additives assessment:
    Evaluate various excipients systematically:

    • Polyols: Glycerol (5-30%), sucrose (5-20%)

    • Detergents: Triton X-100, Tween-20 at low concentrations (0.01-0.1%)

    • Salts: NaCl (100-500mM), ammonium sulfate (50-200mM)

    • Reducing agents: DTT, β-mercaptoethanol (1-5mM)

  • Protein stability monitoring:

    • UV spectroscopy measuring OD280/OD260 ratio to detect nucleic acid contamination

    • Monitoring OD350 to detect aggregation

    • Thermal shift assays to determine melting temperature

    • Dynamic light scattering to assess monodispersity

  • Data analysis using RSM/CCD approach:
    Apply statistical design of experiments to identify optimal combinations of stabilizing factors and potential interaction effects between variables .

The methodology should include regular assessment of protein activity (if known) or stability metrics at defined time points and temperatures to generate reliable stability profiles. The optimization process should yield a formulation that maintains protein integrity during storage and experimental procedures.

What purification strategies would be most effective for isolating SPBC12C2.14c for structural studies?

For structural studies of SPBC12C2.14c, implement a multi-step purification strategy:

  • Initial purification (Capture phase):

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Lysis buffer optimization: NaCl 300mM, Tris 50mM, Imidazole 10mM

    • Sonication parameters: 10 cycles of 30-second pulses with 1-minute rest periods on ice

  • Intermediate purification (Enhancement phase):

    • Ion exchange chromatography based on theoretical pI

    • Size exclusion chromatography to ensure monodispersity

    • Removal of affinity tags using specific proteases (TEV, PreScission)

  • Final polishing (Refinement phase):

    • Second size exclusion chromatography in structural biology buffer

    • Concentration using appropriate molecular weight cutoff filters

    • Quality assessment: SDS-PAGE, Western blot, mass spectrometry, dynamic light scattering

  • Structural preparation:

    • Buffer screening for crystallization or NMR studies

    • Assessment of protein stability at high concentrations

    • Monitoring of aggregation through OD350 and OD280/OD260 ratio

Throughout the purification process, implement rigorous quality control steps to ensure sample homogeneity and purity >95% for structural studies. Consider isotopic labeling strategies (15N, 13C) if NMR studies are planned, which would require expression in minimal media with labeled nitrogen and carbon sources.

What approaches should be used to investigate potential interactions between SPBC12C2.14c and other S. pombe proteins?

To comprehensively investigate protein-protein interactions involving SPBC12C2.14c, implement a multi-method approach:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express SPBC12C2.14c with affinity tags (FLAG, HA, or TAP tag)

    • Perform pull-downs under native conditions

    • Identify binding partners through mass spectrometry

    • Validate interactions using reciprocal pull-downs

  • Proximity-based labeling:

    • BioID or TurboID fusion proteins to identify proximal proteins

    • APEX2 fusion for rapid proximity labeling

    • MS identification of biotinylated proteins

  • Yeast two-hybrid screening:

    • Use SPBC12C2.14c as both bait and prey

    • Screen against S. pombe genomic or cDNA libraries

    • Perform directed tests with candidate interactors

  • In vitro binding assays:

    • Surface plasmon resonance (SPR) or biolayer interferometry

    • Isothermal titration calorimetry (ITC)

    • ELISA-based interaction assays

  • Visualization techniques:

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Co-localization studies using fluorescence microscopy

For each method, include appropriate controls and statistical analysis to distinguish specific from non-specific interactions. Prioritize validation of interactions identified in multiple independent approaches. When interpreting results, consider that uncharacterized proteins may participate in novel complexes or pathways not currently documented in interaction databases.

How can researchers determine the subcellular localization pattern of SPBC12C2.14c?

To determine subcellular localization of SPBC12C2.14c, employ a comprehensive approach combining multiple techniques:

  • Live-cell fluorescence microscopy:

    • C-terminal and N-terminal GFP fusions (construct both to avoid localization artifacts)

    • Time-lapse imaging throughout cell cycle

    • Co-localization with known organelle markers:

      • Nucleus: Histone-RFP

      • ER: Sec61-RFP

      • Golgi: Anp1-RFP

      • Mitochondria: Cox4-RFP

      • Vacuole: FM4-64 staining

  • Immunofluorescence microscopy:

    • Generate specific antibodies against SPBC12C2.14c

    • Alternatively, use antibodies against epitope tags

    • Fixation optimization to preserve structures

    • Multi-channel imaging with organelle markers

  • Biochemical fractionation:

    • Cell lysis and differential centrifugation

    • Separation of nuclear, cytoplasmic, membrane, and organelle fractions

    • Western blot analysis of fractions using antibodies

    • Quantitative analysis of protein distribution

  • Inducible mislocalization:

    • Addition of inducible localization signals (nuclear export/import)

    • Assessment of phenotypic consequences of mislocalization

    • Correlation with protein function

Each experimental approach should include proper controls including known proteins with established localization patterns. Document localization under various growth conditions and stress responses, as cellular localization may be dynamic and condition-dependent in response to environmental changes.

What structural biology techniques would be most appropriate for characterizing SPBC12C2.14c?

For structural characterization of SPBC12C2.14c, select appropriate techniques based on protein properties and research questions:

TechniqueAdvantagesLimitationsSample Requirements
X-ray crystallographyAtomic resolution (1-2Å)Requires crystals5-10mg pure protein, stable crystals
Cryo-EMWorks with larger complexesLower resolution for small proteins100-500μg protein, stable in thin ice
NMR spectroscopySolution dynamics, interactionsSize limitation (~30kDa)15N/13C labeled protein, 1-5mM concentration
Small-angle X-ray scattering (SAXS)Low-resolution envelope, flexibilityNo atomic details50-100μg protein, monodisperse sample
AlphaFold2 predictionNo experimental sample neededAccuracy varies with homologySequence only

Given that SPBC12C2.14c has a short ORF (336bp) suggesting a small protein of approximately 112 amino acids, both X-ray crystallography and NMR would be suitable primary approaches. The small size makes it ideal for NMR studies, which could provide not only structural information but also dynamics and potential interaction interfaces.

For experimental structure determination, optimize protein expression and purification to obtain stable, homogeneous samples as outlined in section 3.3. Complement experimental approaches with computational predictions from AlphaFold2, and validate structural models through biochemical and biophysical techniques such as circular dichroism, limited proteolysis, and crosslinking mass spectrometry.

How should researchers analyze potential homologs of SPBC12C2.14c across fungal species?

To analyze potential homologs of SPBC12C2.14c across fungal species, implement this comprehensive approach:

  • Sequence-based homology search:

    • PSI-BLAST against fungal genomes with increasing iterations

    • HMMER searches using profile hidden Markov models

    • Sensitive search methods like HHpred to detect remote homologs

    • Synteny analysis to identify positional orthologs

  • Phylogenetic analysis:

    • Multiple sequence alignment using MAFFT or T-Coffee

    • Alignment curation to remove poorly aligned regions

    • Model testing to determine appropriate evolutionary model

    • Maximum likelihood (RAxML, IQ-TREE) and Bayesian methods (MrBayes)

  • Structural homology detection:

    • Structure prediction of SPBC12C2.14c using AlphaFold2

    • Structural alignment against known proteins (DALI, TM-align)

    • Identification of similar folds despite low sequence identity

  • Evolutionary rate analysis:

    • Calculate dN/dS ratios to detect selective pressure

    • Identify conserved residues as potentially functional

    • Analyze coevolution patterns with predicted interacting partners

Create a comprehensive table displaying sequence identity, similarity, coverage, and predicted functional conservation across species. For accurate evolutionary interpretation, consider the chromosome location of SPBC12C2.14c, as subtelomeric regions often evolve more rapidly and display higher variation between strains compared to other chromosomal regions .

What approaches can reveal if SPBC12C2.14c is part of subtelomeric gene families similar to RecQ-type helicase genes?

To determine if SPBC12C2.14c belongs to subtelomeric gene families like the RecQ-type helicase genes (tlh1-4) identified in S. pombe , employ these specialized approaches:

  • Comparative sequence analysis:

    • Align SPBC12C2.14c with known subtelomeric gene families

    • Search for shared domains or sequence motifs characteristic of subtelomeric genes

    • Analyze sequence variations between different strain isolates

  • Genome architecture analysis:

    • Map precise chromosomal location relative to SH (subtelomeric homologous) regions

    • Determine if located in SH-P (telomere-proximal) or SH-D (telomere-distal) regions

    • Assess sequence conservation patterns typical of subtelomeric regions

  • Strain variation analysis:

    • Compare SPBC12C2.14c sequences across natural isolates (like JB strains)

    • Analyze sequence diversity patterns characteristic of subtelomeric genes

    • Determine if variation frequency is higher than genome average

  • Chromatin structure analysis:

    • ChIP-seq for heterochromatin marks (H3K9me, Swi6/HP1)

    • Analysis of transcriptional silencing in subtelomeric regions

    • Assessment of recombination frequencies

If SPBC12C2.14c is located in subtelomeric regions, special sequencing approaches may be needed to accurately characterize it, as standard short-read sequencing often struggles with repetitive regions. Consider long-read sequencing technologies like Oxford Nanopore or PacBio, similar to approaches used for characterizing complete sequences of S. pombe subtelomeres .

How can researchers investigate if SPBC12C2.14c is subject to subtelomeric silencing or heterochromatin regulation?

To investigate potential subtelomeric silencing or heterochromatin regulation of SPBC12C2.14c, implement these specialized approaches:

  • Chromatin immunoprecipitation (ChIP) analysis:

    • ChIP for heterochromatin marks: H3K9me2/3, H3K27me3

    • ChIP for heterochromatin proteins: Swi6/HP1, Clr4

    • ChIP for histones with activation marks as control (H3K4me3, H3K36me3)

    • ChIP-qPCR with primers specific for SPBC12C2.14c and control regions

  • Transcriptional analysis across conditions:

    • RT-qPCR in wild-type and heterochromatin mutants (swi6Δ, clr4Δ)

    • RNA-seq analysis comparing expression in different genetic backgrounds

    • 5' RACE to identify transcription start sites

    • Nuclear run-on assays to measure transcription rates

  • Reporter gene assays:

    • Integration of reporter genes (GFP, lacZ) near SPBC12C2.14c

    • Analysis of reporter expression in different genetic backgrounds

    • Position effect variegation assays

  • Chromosome conformation analysis:

    • 4C or Hi-C to detect interactions with other heterochromatic regions

    • FISH to visualize nuclear localization relative to telomeres

    • Live-cell imaging to track dynamics during cell cycle

If SPBC12C2.14c is subject to subtelomeric silencing, you would expect to observe enrichment of heterochromatin marks, decreased expression compared to euchromatic genes, and derepression in heterochromatin mutants. Understanding the chromatin regulation context is essential for accurate interpretation of gene function, as heterochromatin can impact both expression levels and potential functional roles of genes in these regions .

What CRISPR-based approaches would be most effective for functional analysis of SPBC12C2.14c?

For CRISPR-based functional analysis of SPBC12C2.14c in S. pombe, implement these specialized approaches:

  • CRISPR knockout strategies:

    • Design multiple sgRNAs targeting different regions of SPBC12C2.14c

    • Use Cas9 nuclease for complete gene deletion

    • Implement precise editing with HDR templates containing selection markers

    • Create scarless deletions using transient selection systems

  • CRISPR interference (CRISPRi):

    • dCas9-repressor fusions (dCas9-Mxi1) for transcriptional repression

    • Targetable repression without altering DNA sequence

    • Inducible systems for temporal control of repression

    • Titration of repression levels for dosage studies

  • CRISPR activation (CRISPRa):

    • dCas9-activator fusions for transcriptional upregulation

    • Overcome potential heterochromatin silencing

    • Test for gain-of-function phenotypes

    • Implement in combination with reporter systems

  • CRISPR base editing and prime editing:

    • Create point mutations without double-strand breaks

    • Test the importance of specific residues

    • Engineer protein variants with altered function

    • Generate conditional alleles

When designing CRISPR experiments for uncharacterized genes, implement a graduated approach beginning with complete knockout to determine essentiality, followed by more sophisticated techniques for detailed functional characterization. Include controls targeting well-characterized genes and non-targeting guides as experimental controls. If SPBC12C2.14c is located in heterochromatic regions, optimization of CRISPR efficiency may be required, as heterochromatin can reduce CRISPR targeting efficiency.

How can researchers assess the role of SPBC12C2.14c under various stress conditions?

To comprehensively assess SPBC12C2.14c function under stress conditions, implement this systematic approach:

  • Gene expression analysis under diverse stresses:

    • RT-qPCR time course after exposure to:

      • Temperature stress (cold shock, heat shock)

      • Oxidative stress (H₂O₂, menadione)

      • DNA damage (UV, MMS, hydroxyurea)

      • Nutritional stress (nitrogen starvation, carbon limitation)

      • Osmotic stress (sorbitol, NaCl)

    • RNA-seq for genome-wide context of expression changes

    • Comparison with known stress-responsive genes

  • Phenotypic analysis of deletion/overexpression strains:

    • Spot assays with serial dilutions on stress media

    • Growth curve analysis with automated systems

    • Microscopic analysis of cell morphology under stress

    • Cell survival quantification after acute stress exposure

Stress TypeAssay MethodMeasurementsExpected Timeframe
TemperatureGrowth curves at 20°C, 30°C, 37°CDoubling time, lag phase24-72 hours
OxidativeH₂O₂ sensitivity (0.5-5mM)Colony formation, cell death2-5 days
GenotoxicUV survival curvesSurvival rate vs. dose3-7 days
NutritionalGrowth in minimal mediaBiomass, cell size changes1-2 weeks
  • Protein localization and dynamics under stress:

    • Live-cell imaging of GFP-tagged SPBC12C2.14c during stress response

    • Quantification of localization changes and protein levels

    • FRAP to measure protein mobility changes under stress

  • Genetic interaction analysis under stress:

    • Synthetic genetic array (SGA) under stress conditions

    • Identification of condition-specific genetic interactions

    • Double mutant analysis with known stress response genes

This comprehensive approach will reveal if SPBC12C2.14c has stress-specific functions, potentially uncovering roles that aren't apparent under standard laboratory conditions.

What approaches can be used to investigate potential post-translational modifications of SPBC12C2.14c?

To comprehensively investigate post-translational modifications (PTMs) of SPBC12C2.14c, implement this multi-faceted approach:

  • Mass spectrometry-based PTM mapping:

    • Purify tagged SPBC12C2.14c from S. pombe under different conditions

    • Employ bottom-up proteomics with enrichment strategies:

      • Phosphorylation: TiO₂, IMAC, phospho-antibodies

      • Ubiquitination: K-ε-GG antibodies, TUBEs

      • Acetylation: Anti-acetyl-lysine antibodies

      • SUMOylation: SUMO-TRAPS, immunoprecipitation

    • Apply multiple proteases for comprehensive coverage

    • Perform quantitative analysis across conditions

  • Site-specific mutagenesis validation:

    • Mutate identified PTM sites to non-modifiable residues

    • Create phosphomimetic mutations (S/T to D/E)

    • Assess functional consequences through phenotypic analysis

    • Investigate effects on localization and interactions

  • PTM-specific detection methods:

    • Phos-tag gels for phosphorylation

    • Western blotting with modification-specific antibodies

    • In vitro modification assays with purified enzymes

    • Proximity ligation assays for in situ detection

  • Dynamics and regulation analysis:

    • Time-course studies after stimulation or stress

    • Inhibitor studies to identify responsible enzymes

    • Genetic studies in backgrounds lacking specific modifying enzymes

    • Correlation with cell cycle or developmental stages

Create a comprehensive PTM map identifying the specific residues modified, the type of modification, the cellular conditions promoting modification, and the functional consequences. For uncharacterized proteins, PTM analysis can provide critical insights into regulation, localization signals, and potential functions that might not be evident from sequence analysis alone.

What integrated approaches would provide the most comprehensive characterization of SPBC12C2.14c?

The most comprehensive characterization of SPBC12C2.14c requires an integrated multi-omics approach combining:

  • Genomic context analysis:

    • Precise mapping in the S. pombe genome

    • Assessment of conservation across strains and species

    • Evaluation of chromosomal location effects (e.g., subtelomeric positioning)

    • Analysis of sequence variations and evolutionary pressure

  • Transcriptomic profiling:

    • RNA-seq under multiple conditions

    • Transcription start site mapping (CAGE-seq)

    • mRNA stability assessment

    • Ribosome profiling for translation efficiency

  • Proteomic characterization:

    • Comprehensive PTM mapping

    • Protein-protein interaction network analysis

    • Protein abundance and turnover rates

    • Structural characterization

  • Functional genomics:

    • Phenomic analysis of mutants under diverse conditions

    • Genetic interaction mapping

    • Synthetic lethality screens

    • High-content imaging phenotyping

  • Data integration frameworks:

    • Network-based integration of multi-omics data

    • Machine learning approaches for function prediction

    • Comparative analysis with characterized proteins

    • Pathway and process enrichment analysis

This integrated approach should be implemented as an iterative process, where findings from one methodological approach inform and refine investigations using other techniques. The comprehensive characterization should culminate in testable hypotheses about SPBC12C2.14c function that can be validated through targeted experiments.

How can researchers distinguish between direct and indirect effects when studying an uncharacterized protein like SPBC12C2.14c?

To distinguish between direct and indirect effects when studying SPBC12C2.14c, implement these specialized approaches:

  • Temporal resolution strategies:

    • Rapid induction/repression systems (tetracycline-inducible)

    • Auxin-inducible degron (AID) for rapid protein depletion

    • Time-course analyses with fine temporal resolution

    • Mathematical modeling of response kinetics

  • Direct biochemical validation:

    • In vitro reconstitution with purified components

    • Structure-function mutagenesis studies

    • Catalytic activity assays with direct readouts

    • Single-molecule techniques to observe direct interactions

  • Proximity-based approaches:

    • BioID or TurboID fusion proteins for proximity labeling

    • APEX2 enzyme-based proximity labeling

    • Crosslinking mass spectrometry (XL-MS)

    • FRET/BRET for direct interaction monitoring

  • Genetic approaches:

    • Epistasis analysis with known pathway components

    • Suppressor screens to identify genetic relationships

    • Separation-of-function mutations

    • Specificity controls with related proteins or domains

When interpreting results, construct clear criteria for what constitutes evidence of direct effects (e.g., physical interaction, immediate temporal response, biochemical activity) versus indirect effects. Develop models that explicitly distinguish between primary and secondary effects, and test these models through targeted interventions at different points in the proposed pathway.

What are the key considerations for data management and reproducibility when researching uncharacterized proteins like SPBC12C2.14c?

For robust data management and reproducibility when researching uncharacterized proteins like SPBC12C2.14c, implement these essential practices:

  • Comprehensive documentation and metadata:

    • Detailed experimental protocols with exact conditions

    • Complete strain information including construction methods

    • Primer sequences, plasmid maps, and verification data

    • Raw data preservation with appropriate metadata

    • Detailed computational analysis pipelines

  • Statistical and experimental design considerations:

    • A priori power analysis to determine sample sizes

    • Randomization and blinding procedures where appropriate

    • Appropriate statistical tests with justification

    • Multiple testing correction for high-throughput data

    • Independent biological replicates (n≥3) for all key findings

  • Data and resource sharing:

    • Deposition of data in appropriate repositories:

      • Sequence data: GenBank, ENA

      • Proteomics data: PRIDE, MassIVE

      • Structural data: PDB, BMRB

    • Strain and plasmid sharing through repositories

    • Code sharing through GitHub or similar platforms

    • Preregistration of study designs when appropriate

  • Validation and controls:

    • Multiple orthogonal techniques for key findings

    • Appropriate positive and negative controls

    • Rescue experiments to confirm specificity

    • Independent validation in different laboratories

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.