Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C1347.14c (SPBC1347.14c)

Shipped with Ice Packs
In Stock
Cat. No.
BT2483268
Source
in vitro E.coli expression system
Synonyms
SPBC1347.14c; Putative uncharacterized protein C1347.14c
Quick Inquiry

Description

General Information

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C1347.14c (SPBC1347.14c) is a protein that is produced utilizing a recombinant DNA technology in Schizosaccharomyces pombe, also known as fission yeast . S. pombe is a popular host for expressing and purifying eukaryotic proteins because it allows for post-translational modifications, which are important for the structure and function of eukaryotic proteins . SPBC1347.14c itself is annotated as a "putative uncharacterized protein," which means that its function has not been experimentally determined .

Key identifiers:

  • NCBI Gene ID: 5802830

  • Uniprot ID: Q2HQL6

  • Molecular Weight: 13,376 Da

  • Protein Size: 399 amino acids

Production and Characteristics

SPBC1347.14c recombinant protein is produced using an in vitro E. coli expression system . The recombinant protein is available in both lyophilized and liquid forms . It has greater than 85% purity as determined by SDS-PAGE . The protein is stored at -20 degrees C, and it is recommended to store working aliquots at 4 degrees C for up to one week and to avoid repeated freezing and thawing .

Function and Research

As SPBC1347.14c is a putative uncharacterized protein, its precise function remains unknown . Proteins with unknown functions are identified to broaden understanding of cellular processes and potential biotechnological applications . Several studies employ Schizosaccharomyces pombe to study various cellular processes, including DNA damage repair, and the identification of new proteins contributes to these efforts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
SPBC1347.14c; Putative uncharacterized protein C1347.14c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC1347.14c
Target Protein Sequence
MLLSNKIKHSIFQFFVFPFYYFLLIITEIGFSSCIQYSGLSAYFPIKCTLSLLSSPIRRV QVISDSLNVKGKRLLLVVTAHSRLRVNADIGGLISNIGCGKRPTILSTVNTGSNTSREGK S
Uniprot No.
Q2HQL6

Target Background

Database Links

KEGG: spo:SPBC1347.14c

STRING: 4896.SPBC1347.14c.1

Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.