Recombinant Schizosaccharomyces pombe Putative Uncharacterized Protein C32H8.15 (SPBC32H8.15) is a genetically engineered protein derived from the fission yeast Schizosaccharomyces pombe. Designated by the gene identifier SPBC32H8.15, it is a partial-length recombinant product with an amino acid sequence spanning residues 1–101. The protein is classified as "uncharacterized," indicating limited functional data in current scientific literature .
The partial sequence of SPBC32H8.15 is as follows:
MTFRYSNIAHTLFISIMCLFSIPLCFSLSIFFFLSSHSLSFAIHCYAPLSTSLHCGWPHK VDMQYFFPWSRILRPTWVGRALLSKGGVIEmLGGEAGmLGK
Lowercase residues (e.g., m, e) may denote uncertain or modified amino acids .
| Feature | Description |
|---|---|
| Length | 101 amino acids (partial) |
| Uniprot ID | G2TRQ1 |
| Species | Schizosaccharomyces pombe (fission yeast) |
| Expression Region | Residues 1–101 |
While SPBC32H8.15 remains uncharacterized, its study aligns with broader efforts to elucidate roles of poorly understood proteins in S. pombe. Key research directions include:
Using algorithms like DSSP, secondary structure elements (e.g., α-helices, β-strands) could be inferred. For example:
| Motif | Hypothetical Role |
|---|---|
| α-helices | Structural stabilization or protein-protein interaction sites |
| β-strands | Potential involvement in enzymatic activity or DNA binding |
Limited Functional Data: No published studies directly link SPBC32H8.15 to specific biological pathways.
Partial Sequence: The recombinant form excludes regions critical for full functionality.
Experimental Complexity: Functional assays require custom reagents and tailored protocols.
Protein Function Prediction: Applying machine learning models (e.g., MMSNet from grain protein studies ) to predict molecular roles.
Interaction Mapping: Identifying binding partners via co-IP or affinity chromatography.
Gene Knockout Studies: Assessing phenotypic effects in S. pombe deletion mutants.
| Domain Type | Predicted Role |
|---|---|
| ATP-binding | Energy-dependent processes (speculative) |
| Transmembrane | Cellular transport or signaling (speculative) |
KEGG: spo:SPBC32H8.15
What experimental strategies are recommended for determining the biological function of SPBC32H8.15?
Methodological Answer:
To elucidate SPBC32H8.15's function, researchers should combine gene deletion studies with transcriptomic and phenotypic profiling. For example:
Gene Knockout: Generate ΔSPBC32H8.15 strains using CRISPR-Cas9 or homologous recombination. Monitor growth defects under stress (e.g., oxidative, nutrient deprivation) .
Transcriptome Analysis: Compare RNA-seq data between wild-type and knockout strains to identify differentially expressed genes (Table 1). In a 2021 study, SPBC32H8.15 was upregulated in glycerol/acetate media, suggesting a metabolic role .
Phenotypic Screening: Test sensitivity to cell wall stressors (e.g., calcofluor white) or altered carbon sources .
Table 1: Differentially Expressed Genes in ΔSPBC32H8.15 vs. Wild-Type (Example Data)
| Gene ID | Log2 Fold Change | Function |
|---|---|---|
| SPBC32H8.15 | -4.2 | Putative membrane protein |
| urg2 | +3.1 | Uracil phosphoribosyltransferase |
| gma12 | +2.8 | Galactosyltransferase |
How can researchers validate SPBC32H8.15’s subcellular localization?
Methodological Answer:
Use fluorescent tagging (e.g., GFP or mCherry) under native promoters. For example:
Live-Cell Imaging: Fuse SPBC32H8.15 with GFP via chromosomal integration. Observe localization in live fission yeast cells under confocal microscopy .
Fractionation Studies: Perform differential centrifugation to isolate membrane/organelle fractions. Detect SPBC32H8.15 via Western blot using custom antibodies .
Co-Localization Assays: Compare with markers like Sec61 (ER) or Vph1 (vacuole) .
What bioinformatic tools are critical for prioritizing SPBC32H8.15’s interaction partners?
Methodological Answer:
Combine co-immunoprecipitation (Co-IP) with mass spectrometry and structural modeling:
Co-IP/MS: Immunoprecipitate SPBC32H8.15-TAP tags from lysates. Identify bound proteins via LC-MS/MS (e.g., interactions with Git5 or Gpb1 in heterotrimeric G-proteins) .
AlphaFold2: Predict 3D structure to identify conserved domains (e.g., transmembrane helices) and ligand-binding pockets .
Genetic Interaction Mapping: Use synthetic genetic array (SGA) analysis to identify synthetic lethal/viable partners .
Table 2: Predicted SPBC32H8.15 Interaction Partners (SGA Data)
| Gene ID | Interaction Score | Function |
|---|---|---|
| git5 | -14.5 | G-protein beta subunit |
| gpb1 | -12.1 | G-protein regulatory subunit |
| csn1 | -15.1 | COP9 signalosome component |
How should contradictory data on SPBC32H8.15’s metabolic role be resolved?
Methodological Answer:
Address discrepancies through orthogonal assays and meta-analysis:
Multi-Omics Integration: Correlate transcriptomic data (e.g., upregulation in gluconeogenic conditions ) with metabolomic profiles (GC-MS of ΔSPBC32H8.15 strains).
Phenotypic Rescue: Express SPBC32H8.15 under inducible promoters in knockout strains to confirm phenotype-genotype links .
Comparative Genomics: Analyze conservation across Schizosaccharomyces species to identify critical residues/domains .
What methodologies are optimal for structural characterization of SPBC32H8.15?
Methodological Answer:
Employ hybrid structural biology approaches:
How to reconcile conflicting annotations of SPBC32H8.15 as "dubious" versus "conserved"?
Methodological Answer:
CRISPR-Based Editing: Validate gene annotation by restoring open reading frame (ORF) in ΔSPBC32H8.15 strains and testing phenotypic rescue .
Ribo-Seq: Confirm active translation by mapping ribosome footprints across the SPBC32H8.15 locus .
Phylogenetic Profiling: Compare with orthologs in S. japonicus and S. octosporus to assess evolutionary conservation .