Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C32H8.15 (SPBC32H8.15)

Shipped with Ice Packs
In Stock

Description

Introduction to SPBC32H8.15

Recombinant Schizosaccharomyces pombe Putative Uncharacterized Protein C32H8.15 (SPBC32H8.15) is a genetically engineered protein derived from the fission yeast Schizosaccharomyces pombe. Designated by the gene identifier SPBC32H8.15, it is a partial-length recombinant product with an amino acid sequence spanning residues 1–101. The protein is classified as "uncharacterized," indicating limited functional data in current scientific literature .

Amino Acid Sequence

The partial sequence of SPBC32H8.15 is as follows:
MTFRYSNIAHTLFISIMCLFSIPLCFSLSIFFFLSSHSLSFAIHCYAPLSTSLHCGWPHK VDMQYFFPWSRILRPTWVGRALLSKGGVIEmLGGEAGmLGK
Lowercase residues (e.g., m, e) may denote uncertain or modified amino acids .

FeatureDescription
Length101 amino acids (partial)
Uniprot IDG2TRQ1
SpeciesSchizosaccharomyces pombe (fission yeast)
Expression RegionResidues 1–101

Potential Functional Insights

While SPBC32H8.15 remains uncharacterized, its study aligns with broader efforts to elucidate roles of poorly understood proteins in S. pombe. Key research directions include:

Secondary Structure Prediction

Using algorithms like DSSP, secondary structure elements (e.g., α-helices, β-strands) could be inferred. For example:

MotifHypothetical Role
α-helicesStructural stabilization or protein-protein interaction sites
β-strandsPotential involvement in enzymatic activity or DNA binding

Challenges in Characterization

  1. Limited Functional Data: No published studies directly link SPBC32H8.15 to specific biological pathways.

  2. Partial Sequence: The recombinant form excludes regions critical for full functionality.

  3. Experimental Complexity: Functional assays require custom reagents and tailored protocols.

Future Research Directions

  1. Protein Function Prediction: Applying machine learning models (e.g., MMSNet from grain protein studies ) to predict molecular roles.

  2. Interaction Mapping: Identifying binding partners via co-IP or affinity chromatography.

  3. Gene Knockout Studies: Assessing phenotypic effects in S. pombe deletion mutants.

Table 2: Hypothetical Functional Domains

Domain TypePredicted Role
ATP-bindingEnergy-dependent processes (speculative)
TransmembraneCellular transport or signaling (speculative)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development based on feasibility.
Synonyms
SPBC32H8.15; Putative uncharacterized protein C32H8.15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC32H8.15
Target Protein Sequence
MTFRYSNIAHTLFISIMCLFSIPLCFSLSIFFFLSSHSLSFAIHCYAPLSTSLHCGWPHK VDMQYFFPWSRILRPTWVGRALLSKGGVIEMLGGEAGMLGK
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What experimental strategies are recommended for determining the biological function of SPBC32H8.15?

    • Methodological Answer:
      To elucidate SPBC32H8.15's function, researchers should combine gene deletion studies with transcriptomic and phenotypic profiling. For example:

      • Gene Knockout: Generate ΔSPBC32H8.15 strains using CRISPR-Cas9 or homologous recombination. Monitor growth defects under stress (e.g., oxidative, nutrient deprivation) .

      • Transcriptome Analysis: Compare RNA-seq data between wild-type and knockout strains to identify differentially expressed genes (Table 1). In a 2021 study, SPBC32H8.15 was upregulated in glycerol/acetate media, suggesting a metabolic role .

      • Phenotypic Screening: Test sensitivity to cell wall stressors (e.g., calcofluor white) or altered carbon sources .

    Table 1: Differentially Expressed Genes in ΔSPBC32H8.15 vs. Wild-Type (Example Data)

    Gene IDLog2 Fold ChangeFunction
    SPBC32H8.15-4.2Putative membrane protein
    urg2+3.1Uracil phosphoribosyltransferase
    gma12+2.8Galactosyltransferase

    Source: Adapted from

  • How can researchers validate SPBC32H8.15’s subcellular localization?

    • Methodological Answer:
      Use fluorescent tagging (e.g., GFP or mCherry) under native promoters. For example:

      • Live-Cell Imaging: Fuse SPBC32H8.15 with GFP via chromosomal integration. Observe localization in live fission yeast cells under confocal microscopy .

      • Fractionation Studies: Perform differential centrifugation to isolate membrane/organelle fractions. Detect SPBC32H8.15 via Western blot using custom antibodies .

      • Co-Localization Assays: Compare with markers like Sec61 (ER) or Vph1 (vacuole) .

Advanced Research Questions

  • What bioinformatic tools are critical for prioritizing SPBC32H8.15’s interaction partners?

    • Methodological Answer:
      Combine co-immunoprecipitation (Co-IP) with mass spectrometry and structural modeling:

      • Co-IP/MS: Immunoprecipitate SPBC32H8.15-TAP tags from lysates. Identify bound proteins via LC-MS/MS (e.g., interactions with Git5 or Gpb1 in heterotrimeric G-proteins) .

      • AlphaFold2: Predict 3D structure to identify conserved domains (e.g., transmembrane helices) and ligand-binding pockets .

      • Genetic Interaction Mapping: Use synthetic genetic array (SGA) analysis to identify synthetic lethal/viable partners .

    Table 2: Predicted SPBC32H8.15 Interaction Partners (SGA Data)

    Gene IDInteraction ScoreFunction
    git5-14.5G-protein beta subunit
    gpb1-12.1G-protein regulatory subunit
    csn1-15.1COP9 signalosome component

    Source:

  • How should contradictory data on SPBC32H8.15’s metabolic role be resolved?

    • Methodological Answer:
      Address discrepancies through orthogonal assays and meta-analysis:

      • Multi-Omics Integration: Correlate transcriptomic data (e.g., upregulation in gluconeogenic conditions ) with metabolomic profiles (GC-MS of ΔSPBC32H8.15 strains).

      • Phenotypic Rescue: Express SPBC32H8.15 under inducible promoters in knockout strains to confirm phenotype-genotype links .

      • Comparative Genomics: Analyze conservation across Schizosaccharomyces species to identify critical residues/domains .

  • What methodologies are optimal for structural characterization of SPBC32H8.15?

    • Methodological Answer:
      Employ hybrid structural biology approaches:

      • Cryo-EM: Resolve full-length SPBC32H8.15 purified from S. pombe membranes in lipid nanodiscs .

      • X-Ray Crystallography: Co-crystallize with putative substrates (e.g., GTP analogs) identified via docking studies .

      • NMR Spectroscopy: Map dynamic regions using 2D 15N^{15}\text{N}-1H^{1}\text{H} HSQC spectra .

Data Contradiction Analysis

  • How to reconcile conflicting annotations of SPBC32H8.15 as "dubious" versus "conserved"?

    • Methodological Answer:

      • CRISPR-Based Editing: Validate gene annotation by restoring open reading frame (ORF) in ΔSPBC32H8.15 strains and testing phenotypic rescue .

      • Ribo-Seq: Confirm active translation by mapping ribosome footprints across the SPBC32H8.15 locus .

      • Phylogenetic Profiling: Compare with orthologs in S. japonicus and S. octosporus to assess evolutionary conservation .

Key Research Findings

  • SPBC32H8.15 is upregulated 3.5-fold in glycerol/acetate media, implicating it in gluconeogenesis .

  • Genetic interaction data link SPBC32H8.15 to G-protein signaling (Git5/Gpb1) and COP9 complexes .

  • Structural predictions suggest 4 transmembrane domains and a cytoplasmic ATPase domain .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.