Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C338.03c (SPCC338.03c)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C338.03c (SPCC338.03c) is a protein derived from the fission yeast Schizosaccharomyces pombe . S. pombe is a species of yeast used widely in biological research . SPCC338.03c is referred to as a "dubious" protein, and is considered a putative uncharacterized protein .

Characteristics

CharacteristicDescription
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Product TypeRecombinant Protein
Uniprot IDA6X993
Amino Acid SequenceMVISSVFSAFADIPSVYLISVNCGARELWLTITSIHFVSLREQRYEFLANSLGERTSSLKSQEEMVSVSRNGKQLLSEASFFRLGKHVHLNFLPFENTFEMALRNDFQIFCTSILFTCYIQSFSLLISNFFIAIEVSRSFF
Sequence Length141 amino acids
Gene NameSPCC338.03c
Expression Region1-141
FunctionPutative, uncharacterized protein

Research Findings

  • Genome-Wide Screening S. pombe’s genome-wide deletion library was screened for mutants sensitive to DNA-damaging agents. SPCC338.03c was among the identified mutants sensitive to γ-irradiation .

  • Role in Gut Microbiome SPCC338.03c is found in the stool samples of both healthy individuals and patients with colorectal cancer, suggesting its presence in the human gut microbiome .

  • Mating-Type Switching: While not directly linked, research on S. pombe mating-type switching has identified factors involved in donor selection during gene conversion events, offering context for genetic studies in this yeast .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SPCC338.03c; Putative uncharacterized protein C338.03c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC338.03c
Target Protein Sequence
MVISSVFSAFADIPSVYLISVNCGARELWLTITSIHFVSLREQRYEFLANSLGERTSSLK SQEEMVSVSRNGKQLLSEASFFRLGKHVHLNFLPFENTFEMALRNDFQIFCTSILFTCYI QSFSLLISNFFIAIEVSRSFF
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genomic context of SPCC338.03c in S. pombe?

SPCC338.03c is one of approximately 4940 protein-coding genes in the S. pombe genome. S. pombe was the sixth eukaryote to be sequenced and has the smallest number of open reading frames (ORFs) in a eukaryote reported by 2003 . While specific information about SPCC338.03c's genomic location isn't available in the current literature review, uncharacterized proteins in S. pombe are typically studied within the context of their chromosomal positioning and neighboring genes, as demonstrated in comprehensive deletion studies of chromosomal regions .

How do researchers determine if SPCC338.03c is essential for S. pombe viability?

Researchers typically employ PCR-based gene deletion procedures to determine if a gene is essential. The methodology involves:

  • Designing primers with 80bp homology to regions flanking the target gene

  • Amplifying a replacement cassette containing a selectable marker (typically a kanamycin/G418 resistance gene)

  • Transforming the deletion construct into diploid S. pombe cells

  • Selecting for transformants on appropriate media

  • Inducing sporulation and analyzing the resulting haploid progeny

If no viable haploid deletion mutants can be recovered despite efficient transformation, the gene is considered essential. Based on genome-wide studies, approximately 17.5% of S. pombe genes are essential for vegetative growth .

What phylogenetic classification might SPCC338.03c belong to?

Without specific information about SPCC338.03c, we can outline the standard phylogenetic classification system used for S. pombe proteins:

ClassDescriptionPercentage of S. pombe proteinsEssentiality correlation
IaFound in prokaryotes and all eukaryotes21.5-24%Highest essentiality
IbSpecific to eukaryotes, absent in prokaryotes21.5-24%Moderate essentiality
II/IIIPresent in prokaryotes and some eukaryotes but absent in metazoa~10%Variable essentiality
IVPresent in metazoa but absent in S. cerevisiae4.4%Variable essentiality
VS. pombe-specific proteins19%Lowest essentiality

Phylogenetic analysis would help determine whether SPCC338.03c is conserved across species or specific to S. pombe, providing insights into its evolutionary significance and potential function .

What are the most effective methods for expressing and purifying recombinant SPCC338.03c protein?

For expressing and purifying an uncharacterized S. pombe protein like SPCC338.03c, researchers should consider:

  • Expression system selection:

    • E. coli systems (BL21, Rosetta) for high yield but potential folding issues

    • S. pombe expression systems for native post-translational modifications

    • Baculovirus-insect cell systems for complex eukaryotic proteins

  • Tagging strategy:

    • N-terminal vs. C-terminal tags (His, GST, MBP)

    • Removable tags with protease cleavage sites

    • Assessment of tag interference with protein function

  • Purification protocol:

    • Initial capture via affinity chromatography

    • Secondary purification via ion exchange or size exclusion

    • Buffer optimization for stability

When working with uncharacterized proteins, it's advisable to test multiple expression constructs in parallel, varying tags and expression conditions to determine optimal yield and solubility.

How can researchers determine subcellular localization of SPCC338.03c?

Determining subcellular localization involves multiple complementary approaches:

  • Fluorescent protein fusion:

    • C-terminal or N-terminal GFP/YFP tagging under native promoter

    • Confirmation that the fusion protein is functional

    • Live-cell imaging under various growth conditions

  • Immunofluorescence:

    • Generation of specific antibodies against SPCC338.03c

    • Fixation optimization for S. pombe (typically formaldehyde-based)

    • Co-staining with organelle markers

  • Biochemical fractionation:

    • Sequential extraction of cellular compartments

    • Western blot analysis of fractions

    • Mass spectrometry validation

  • Bioinformatic prediction:

    • Signal peptide and transmembrane domain analysis

    • Comparison with localization of orthologs in other species

Comprehensive studies of S. pombe genes show that protein localization often correlates with function and essentiality, with nuclear proteins having higher rates of essentiality than cytoplasmic proteins .

What are the optimal conditions for assessing SPCC338.03c expression changes during cellular stress?

Based on studies of gene expression changes during cellular stress in S. pombe:

  • Experimental design should include:

    • Appropriate reference strains (minimum of two, as demonstrated in telomere studies)

    • Time-course sampling to capture dynamic expression changes

    • Biological replicates (typically 3-5) to ensure statistical significance

  • Stress conditions relevant to S. pombe:

    • Oxidative stress (H₂O₂, menadione)

    • DNA damage (MMS, UV, hydroxyurea)

    • Heat shock (39-42°C)

    • Nutrient deprivation

    • Osmotic stress (KCl, sorbitol)

  • Expression analysis methods:

    • RT-qPCR for targeted analysis

    • Microarray or RNA-seq for genome-wide profiling

    • Western blotting for protein-level confirmation

Researchers should note that approximately 44% of genes responding to telomere dysfunction in S. pombe overlap with the Core Environmental Stress Response (CESR), indicating that many stress responses share common elements .

How can researchers conduct comprehensive protein-protein interaction studies for SPCC338.03c?

For uncharacterized proteins like SPCC338.03c, a multi-tiered approach to protein interaction studies is recommended:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Tandem affinity purification (TAP) tagging of SPCC338.03c

    • Optimization of lysis and purification conditions to preserve interactions

    • Quantitative proteomics to differentiate specific from non-specific interactions

  • Yeast two-hybrid screening:

    • Using both N-terminal and C-terminal fusion constructs as bait

    • Screening against full-genome S. pombe libraries

    • Validation of interactions via co-immunoprecipitation

  • Proximity-based labeling:

    • BioID or TurboID fusion to SPCC338.03c

    • In vivo biotinylation of proximal proteins

    • Streptavidin pulldown and mass spectrometry identification

  • Genetic interaction mapping:

    • Synthetic genetic array (SGA) analysis

    • Systematic construction of double mutants

    • Analysis of genetic interactions to infer functional relationships

Interaction data should be interpreted in the context of S. pombe's evolutionary position and gene conservation patterns, as proteins in class Ia (conserved across all domains of life) often interact with other highly conserved proteins .

What strategies can address the challenges of studying an uncharacterized protein with no known functional domains?

When facing the challenge of characterizing a protein without recognized domains:

  • Structural analysis approaches:

    • Ab initio structure prediction using AlphaFold2

    • X-ray crystallography or cryo-EM structural determination

    • Structure-based functional inference

  • Evolutionary analysis:

    • Remote homology detection using sensitive methods (HHpred, HMMER)

    • Phylogenetic profiling across diverse species

    • Co-evolution analysis with potential functional partners

  • High-throughput phenotypic screening:

    • Chemical genetic interactions using diverse compound libraries

    • Systematic environmental condition testing

    • Suppressor/enhancer screens with known pathway mutants

  • Metabolomic/proteomic profiling:

    • Comparative metabolomics between wild-type and deletion strains

    • Phosphoproteomics to identify changes in signaling networks

    • RNA-protein interaction studies (if RNA-binding is suspected)

The absence of recognizable domains doesn't preclude important functions; S. pombe-specific proteins (Class V) make up approximately 19% of the proteome and can be critical for species-specific processes .

How can researchers determine if SPCC338.03c expression is regulated by RNAi mechanisms?

Based on findings that some S. pombe genes are regulated by RNAi mechanisms:

  • Expression analysis in RNAi-deficient strains:

    • Compare SPCC338.03c transcript levels in wild-type vs. Δdcr1 and Δago1 strains

    • Perform RT-qPCR and Northern blot analysis to quantify expression changes

    • Include positive controls known to be regulated by RNAi

  • Small RNA profiling:

    • Sequence small RNAs that map to the SPCC338.03c locus

    • Compare abundance in wild-type vs. RNAi mutants

    • Analyze strand specificity and size distribution of small RNAs

  • Chromatin immunoprecipitation (ChIP):

    • Assess H3K9 methylation levels at the SPCC338.03c locus

    • Determine RNA Pol II occupancy

    • Examine binding of RNAi components (Ago1, Rdp1, etc.)

  • Reporter assays:

    • Construct reporters with SPCC338.03c promoter or potential regulatory elements

    • Test expression in wild-type and RNAi mutant backgrounds

    • Map minimal sequence elements required for RNAi regulation

Studies in S. pombe have demonstrated that RNAi can regulate gene expression, particularly for genes with homology to centromeric repeats and for certain helicase-like genes that show expression changes during cellular stress responses .

What troubleshooting approaches can be used when PCR-based deletion of SPCC338.03c fails?

When PCR-based gene deletion is unsuccessful, consider these approaches:

  • Technical optimization:

    • Increase homology arms length from standard 80bp to 200-500bp

    • Test different polymerases and PCR conditions

    • Use colony PCR on more transformants to identify rare deletion events

  • Alternative deletion strategies:

    • CRISPR-Cas9 mediated deletion

    • Two-step replacement using ura4+ counterselection

    • Inducible degradation systems (auxin-inducible or temperature-sensitive degrons)

  • Chromosomal context analysis:

    • Check if the gene is in a deletion-resistant region

    • Analyze local chromatin structure and modification state

    • Test for presence of essential overlapping genes or regulatory elements

It's worth noting that in deletion studies of S. pombe, researchers have encountered chromosomal regions where multiple adjacent genes resist deletion despite not being in recombination cold spots. For example, a segment of chromosome II containing 8 of 9 genes within an 18 kb region could not be deleted using standard PCR-based approaches .

How can researchers distinguish between technical failures and biological essentiality when attempting to delete SPCC338.03c?

To determine whether deletion failure represents true essentiality:

  • Control experiments:

    • Include positive controls (known non-essential genes) in the same experiment

    • Test your deletion methodology on genes with known deletion phenotypes

    • Measure transformation efficiency with a control plasmid

  • Complementation testing:

    • Introduce a wild-type copy of SPCC338.03c at an ectopic location

    • Attempt deletion in the presence of the complementing gene

    • Test if successful deletion is now possible

  • Conditional approaches:

    • Create a strain with SPCC338.03c under an inducible/repressible promoter

    • Switch off expression and observe phenotypic consequences

    • Use a temperature-sensitive allele if available

  • Tetrad analysis:

    • Delete one copy in a diploid strain

    • Induce sporulation and analyze tetrads

    • Essential genes will show 2:2 segregation of viable:inviable spores

The essentiality of a gene often correlates with its phylogenetic classification, with ancient conserved genes (Class Ia) showing higher rates of essentiality than species-specific genes (Class V) .

How does the conservation pattern of SPCC338.03c inform its potential function?

Without specific information about SPCC338.03c's conservation, here's how researchers can approach conservation analysis:

  • Conservation analysis across taxonomic categories:

    • Identify orthologs in diverse species using bidirectional best BLAST hits

    • Perform sensitive homology detection using profile methods

    • Analyze domain architecture conservation

  • Interpretation framework based on S. pombe studies:

Conservation patternFunctional implicationsEssentiality probability
Conserved across all domains (Class Ia)Core cellular processes (translation, DNA replication, etc.)25-40%
Eukaryote-specific (Class Ib)Eukaryotic innovations (nuclear transport, etc.)15-25%
Lost in S. cerevisiae lineage (Class IV)Function potentially replaced in budding yeast10-20%
S. pombe-specific (Class V)Species-specific adaptations<10%
  • Sequence evolution rate analysis:

    • Calculate Ka/Ks ratios to detect selection pressure

    • Identify conserved motifs that may indicate functional sites

    • Analyze coevolution with interacting partners

S. pombe studies have shown that ancient genes that have been lost in the S. cerevisiae lineage but maintained in S. pombe and metazoans are rarely essential, suggesting evolutionary replacement of their functions .

If SPCC338.03c has no direct ortholog in S. cerevisiae, what research approaches are most valuable?

When studying S. pombe proteins without S. cerevisiae orthologs:

  • Metazoan ortholog functional comparison:

    • Identify orthologs in model organisms (C. elegans, D. melanogaster, H. sapiens)

    • Consider complementation experiments with metazoan orthologs

    • Use insights from metazoan studies to guide S. pombe research

  • S. pombe-specific biological context:

    • Focus on processes where S. pombe differs from S. cerevisiae

    • Consider cell cycle regulation, centromere structure, RNAi mechanisms

    • Investigate meiosis and sexual differentiation pathways

  • Comparative genomics beyond orthologs:

    • Look for functional analogs rather than orthologs

    • Consider gene family expansions/contractions

    • Analyze genomic context and synteny

Approximately 4.4% of S. pombe proteins share homology with proteins from metazoa but lack homologs in S. cerevisiae (Class IV). These proteins may represent ancient functions lost in the S. cerevisiae lineage but retained in the S. pombe and metazoan lineages .

How can transcriptomic data be leveraged to understand SPCC338.03c function during cellular stress responses?

Integration of transcriptomic data requires:

  • Expression correlation analysis:

    • Generate correlation networks using genome-wide expression data

    • Identify genes with expression patterns similar to SPCC338.03c

    • Perform Gene Ontology enrichment analysis on correlated gene sets

  • Stress response profiling:

    • Measure SPCC338.03c expression across diverse stress conditions

    • Determine if it belongs to the Core Environmental Stress Response (CESR)

    • Compare with expression changes during telomere dysfunction

  • Data integration strategies:

    • Combine expression data with protein interaction networks

    • Integrate with ChIP-seq data to identify potential regulators

    • Compare with metabolomic changes during stress

Studies in S. pombe have identified distinct waves of gene expression changes during cellular stress, such as telomere dysfunction, with approximately 110 genes changing expression during crisis, 44% of which overlap with the CESR .

What computational approaches can predict the function of SPCC338.03c when experimental data is limited?

Advanced computational prediction approaches include:

  • Machine learning-based function prediction:

    • Train models on known protein attributes (localization, expression, interactions)

    • Apply models to predict SPCC338.03c function

    • Validate predictions with targeted experiments

  • Network-based inference:

    • Construct functional networks integrating diverse data types

    • Apply guilt-by-association algorithms

    • Use random walk or diffusion methods to propagate functional annotations

  • Structural prediction and analysis:

    • Generate 3D structure predictions using AlphaFold2

    • Identify potential ligand-binding pockets

    • Perform in silico docking with potential substrates

  • Text mining and knowledge extraction:

    • Analyze scientific literature for indirect functional associations

    • Extract information from databases across multiple species

    • Identify experimental conditions where similar proteins are studied

For uncharacterized S. pombe proteins, integrating diverse data types significantly improves functional prediction accuracy compared to using single data sources alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.