Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C576.19c (SPCC576.19c)

Shipped with Ice Packs
In Stock

Description

General Information

The protein SPCC576.19c is a putative uncharacterized protein from the fission yeast Schizosaccharomyces pombe . S. pombe is a well-studied model organism in molecular biology, particularly useful for studying cell division, cell wall synthesis, and meiosis . Genes with the "SPCC" prefix are part of a naming convention for genes in Schizosaccharomyces pombe .

Orthologs and Synonyms

  • Synonyms: pxa1; SPAC5D6.07c; PXA domain protein 1

  • UniProt ID: O14200

  • SPCC576.19c may also be referred to as Uncharacterized protein C5D6.07c (SPAC5D6.07c) .

Basic Characteristics

CharacteristicValue
OrganismSchizosaccharomyces pombe
Protein LengthFull Length (1-495 amino acids)
TagHis-Tagged (N-terminal)
SourceE. coli
PurityGreater than 90% as determined by SDS-PAGE
Predicted Species ReactivitySchizosaccharomyces pombe

Amino Acid Sequence

The amino acid sequence for the Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C5D6.07c (SPAC5D6.07c) Protein is :
MAKLSSLLNPIISKILEIYVYSWYSGISKDALFPSQCEQVGGSIVHELEKRLSRQDAMDLLFYEIPFLLIKHIENTEEAKLRFALPQGQILEIDTIYHSLHPHIALEKEENELVYCRLLVEDILKYLLPATNSKSEIECVILREALAVQIHKSIQVASSPETMYKFIIYLSKAILQPSRR
PWKESITTAVRWVWHAFRILLITRGVPYFSTAWFQFYLKLFSQKDNVSSSDLTRWFFFYTLLYPWIALVSAFVAETMTLCCIVTIFYDKNVNRQWKQYILTSVSNMDKGNPSGGSQSTNVTTFRRFSQSSYPRRSNYRRRISTSSKSLYELSPSKFKSIPITSNPPPMLNLSKGSTSVEPTFCETNASVALSTVTSTPVFSTDSSPLSSRTRENLLSLIPSAVSSPTKANTNKSHQRSFSIPKATKDSQTPSENSAATLKQAAIDAYSQIPVIPFFLPSDKLIMLVESEYRNKHIFYSLLNSFTMVMFPELRHTK

Production and Expression

Recombinant SPCC576.19c is typically produced in E. coli and tagged with histidine (His) to facilitate purification . Schizosaccharomyces pombe can be used as a host for the expression and purification of eukaryotic proteins, offering post-translational modifications that are critical for the structure and function of eukaryotic proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPCC576.19c; Putative uncharacterized protein C576.19c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC576.19c
Target Protein Sequence
MPTSSNDLYQTRLDVQTPNRWFLYISLELFNNMYSPFRSSSVLLSGAQSDIPKVGKCLFL PCRSLEFRASANSLSVHFLLNVISAILSMLIERYAVEVIMSKITWPRSNEDWRFHGIKG
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What experimental approaches are recommended for initial characterization of SPCC576.19c?

For initial characterization of SPCC576.19c, a multidimensional biochemical prefractionation approach followed by LC ESI MS/MS analysis is highly recommended. This methodology has successfully identified approximately 30% of the theoretical fission yeast proteome and would be appropriate for uncharacterized proteins . Begin with total cell lysate from wild-type fission yeast cells growing vegetatively in mid-log phase in rich media. Fractionate the lysate using preparative isoelectric focusing on immobilized pH gradients, one-dimensional gel electrophoresis, and strong ion-exchange chromatography. Subsequently analyze individual fractions by LC ESI MS/MS to detect peptides corresponding to your protein of interest .

How can I design genetic experiments to study the function of SPCC576.19c in S. pombe?

When designing genetic experiments to study SPCC576.19c function:

  • First, create deletion strains using homologous recombination techniques to generate a SPCC576.19c knockout.

  • Perform comparative phenotypic analysis between wild-type and knockout strains under various growth conditions.

  • Consider tetrad analysis to study potential meiotic functions, as S. pombe is well-suited for studying meiotic recombination .

  • Implement both random spore and tetrad analyses to examine potential effects on intragenic recombination (gene conversion), intergenic recombination (crossing-over), and spore viability .

Remember that S. pombe has only three chromosomes and produces many viable meiotic products (spores) even when recombination-deficient, which facilitates analysis of mutations affecting meiotic recombination .

What are the advantages of using S. pombe as a model organism for studying uncharacterized proteins like SPCC576.19c?

S. pombe offers several significant advantages for studying uncharacterized proteins:

  • Ease of genetic manipulation and the ability to analyze many independent meioses (>10^8) in a single experiment .

  • Production of viable meiotic products (spores) even in recombination-deficient strains, with 10-20% viability compared to wild type .

  • Availability of isogenic strains, facilitating exchange of alleles and comparison of results between different laboratories .

  • Representation of metazoan "core" proteins at a higher rate (47%) compared to the entire proteome (30%), suggesting conservation of essential protein functions across species .

  • Well-established methodologies for both transcriptomic and proteomic analyses, enabling multi-omics approaches to protein characterization .

How should I design experiments to resolve potential contradictory findings about SPCC576.19c function?

When faced with contradictory findings about SPCC576.19c function, implement a systematic approach to experimental design:

Table 1: Framework for Resolving Contradictory Findings

Contextual CategoryExamplesExperimental Approach
Internal to cell systemCell cycle stage, genetic backgroundSynchronize cultures, use isogenic strains
External to cell systemGrowth media, temperatureStandardize conditions across experiments
Endogenous/exogenous factorsProtein modifications, environmental stressTest under multiple defined conditions
Known controversyConflicting literatureReplicate both methodologies side-by-side
Methodological differencesDetection techniquesApply multiple orthogonal techniques

What proteomic approaches would be most effective for quantifying SPCC576.19c expression levels?

For effective quantification of SPCC576.19c expression levels, a label-free quantification approach based on spectral counts normalized to the number of predicted tryptic peptides is recommended . This method has successfully quantified 1465 proteins in S. pombe and shown considerable correlations with mRNA levels .

The methodology should include:

  • Extensive biochemical prefractionation of total cell lysate from wild-type fission yeast cells.

  • Analysis of individual fractions by liquid chromatography coupled with electrospray ionization tandem mass spectrometry (LC ESI MS/MS).

  • Statistical modeling to normalize spectral counts to the number of predicted tryptic peptides.

  • Comparative analysis with transcriptomic data to assess mRNA-protein correlation .

For comprehensive coverage, combine multiple prefractionation techniques, as individual techniques contribute differently to total protein detection .

How can I assess whether SPCC576.19c is part of a protein complex?

To determine if SPCC576.19c participates in protein complexes:

  • Implement co-immunoprecipitation studies using tagged versions of SPCC576.19c, followed by mass spectrometry to identify interacting partners.

  • Perform functional pathway analysis of expression data, as proteins involved in complexes often cluster in groups with similar mRNA-protein ratios .

  • Use self-organizing map clustering of large-scale protein and mRNA data to reveal coordinate expression of components of functional pathways and protein complexes .

  • Consider that the mRNA-protein correlation tends to be increasingly discordant for components of protein complexes compared to proteins involved in signaling and metabolic processes .

  • Apply blue native PAGE or size-exclusion chromatography to isolate intact protein complexes.

What genetic approaches are recommended for determining the essentiality of SPCC576.19c?

To determine if SPCC576.19c is essential:

  • Create heterozygous diploid deletion strains using homologous recombination, then induce sporulation and analyze tetrad dissection patterns .

  • Implement a conditional expression system (e.g., using the nmt1 promoter) that allows regulated expression of SPCC576.19c.

  • Consider that essential and non-essential proteins are equally represented (36%) in proteomic studies of S. pombe, which aids in comparative analysis .

  • Use tetrad analysis to thoroughly examine spore viability patterns, which can distinguish between essential and non-essential genes .

  • Implement a CRISPR-Cas9 approach with inducible guide RNAs as an alternative genetic manipulation strategy.

How should I analyze potential post-translational modifications of SPCC576.19c?

For comprehensive analysis of post-translational modifications (PTMs):

  • Implement enrichment strategies specific to the PTM of interest (e.g., phosphopeptide enrichment for phosphorylation).

  • Use high-resolution mass spectrometry with electron transfer dissociation (ETD) or higher-energy collisional dissociation (HCD) fragmentation methods.

  • Apply multiple proteases beyond trypsin (e.g., chymotrypsin, AspN) to increase sequence coverage.

  • Consider that the correlation between mRNA and protein levels might be affected by PTMs, particularly for regulatory proteins .

  • Compare PTM patterns across different growth conditions and genetic backgrounds to identify functional significance.

What approaches can I use to study the subcellular localization of SPCC576.19c?

To determine the subcellular localization of SPCC576.19c:

  • Generate GFP-tagged fusion constructs at either N- or C-terminus, ensuring preservation of protein function.

  • Perform live-cell imaging using confocal microscopy across different cell cycle stages.

  • Use co-localization studies with known organelle markers to precisely identify subcellular compartments.

  • Consider proteomics fractionation data, as previous studies undersampled proteins containing predicted transmembrane domains (14%) and likely membrane-associated proteins .

  • Implement immunogold electron microscopy for higher-resolution localization studies if antibodies are available.

How can I effectively compare SPCC576.19c with orthologous proteins in other yeast species?

For effective comparative analysis with orthologous proteins:

  • Apply self-organizing map clustering of large-scale protein and mRNA data from fission and budding yeast to reveal coordinate but not always concordant expression patterns .

  • Consider that S. pombe-specific proteins are represented at the same rate (30%) as the entire proteome in proteomic studies .

  • Recognize the considerable divergence in gene expression patterns between fission yeast and budding yeast observed in previous transcriptomic studies and confirmed at the protein level .

  • Perform sequence and structural homology analyses to identify conserved functional domains.

  • Compare phenotypes of deletion mutants across yeast species to identify conserved functional roles.

What bioinformatic tools are most useful for predicting the function of uncharacterized proteins like SPCC576.19c?

The most effective bioinformatic tools for function prediction include:

  • Sequence homology tools (BLAST, HMMER) to identify distant relatives and conserved domains.

  • Structural prediction algorithms (AlphaFold, RoseTTAFold) to generate protein structure models.

  • Gene neighborhood analysis to identify functional associations based on genomic context.

  • Co-expression network analysis using the extensive proteomic and transcriptomic datasets available for S. pombe .

  • GO term enrichment analysis of interacting partners to infer potential biological processes.

How should I integrate transcriptomic and proteomic data to understand SPCC576.19c regulation?

For effective integration of transcriptomic and proteomic data:

  • Recognize that mRNA-protein correlation is strong for proteins involved in signaling and metabolic processes but increasingly discordant for components of protein complexes .

  • Use label-free quantification approaches normalized to predicted tryptic peptides to accurately quantify protein levels .

  • Apply functional pathway analysis to categorize genes/proteins based on their mRNA-protein correlation patterns .

  • Implement self-organizing map clustering to identify coordinate expression patterns .

  • Consider that the correlation between mRNA and protein abundance may vary depending on the cellular context and experimental conditions.

How can I resolve contradictory findings about SPCC576.19c from different research groups?

To resolve contradictions in the literature:

  • Categorize the contradictions based on contextual characteristics: internal to the patient/organism, external to the patient/organism, endogenous/exogenous factors, known controversies, or methodological differences .

  • Examine the detailed experimental conditions used in each study, as subtle differences can significantly impact results.

  • Consider that automated text analysis techniques can help extract claims from the literature and flag potentially contradictory findings .

  • Implement a systematic approach to experimental design that specifically addresses the identified contradictions .

  • Collaborate directly with the research groups reporting contradictory findings to resolve methodological differences.

What are the most reliable methods for validating protein-protein interactions involving SPCC576.19c?

For validating protein-protein interactions:

  • Use multiple orthogonal approaches: co-immunoprecipitation, yeast two-hybrid, bimolecular fluorescence complementation, and proximity labeling.

  • Perform reciprocal tagging experiments to confirm interactions from both directions.

  • Validate interactions under native expression conditions rather than relying solely on overexpression systems.

  • Consider that proteins involved in complexes often show similar mRNA-protein ratio patterns .

  • Implement quantitative interaction proteomics using SILAC or TMT labeling to differentiate specific from non-specific interactions.

How can I design a comprehensive study to determine if SPCC576.19c is involved in meiotic recombination?

To investigate potential roles in meiotic recombination:

  • Generate SPCC576.19c deletion strains and assess effects on spore viability, as S. pombe produces viable meiotic products even in recombination-deficient strains .

  • Implement genetic assays of intragenic recombination (gene conversion), intergenic recombination (crossing-over), and spore viability .

  • Perform both random spore and tetrad analyses to comprehensively characterize recombination phenotypes .

  • Consider that S. pombe has only three chromosomes, which facilitates the analysis of recombination defects .

  • Compare phenotypes with known recombination mutants to position SPCC576.19c in the established pathway of meiotic recombination for S. pombe .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.