The protein SPCC576.19c is a putative uncharacterized protein from the fission yeast Schizosaccharomyces pombe . S. pombe is a well-studied model organism in molecular biology, particularly useful for studying cell division, cell wall synthesis, and meiosis . Genes with the "SPCC" prefix are part of a naming convention for genes in Schizosaccharomyces pombe .
The amino acid sequence for the Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C5D6.07c (SPAC5D6.07c) Protein is :
MAKLSSLLNPIISKILEIYVYSWYSGISKDALFPSQCEQVGGSIVHELEKRLSRQDAMDLLFYEIPFLLIKHIENTEEAKLRFALPQGQILEIDTIYHSLHPHIALEKEENELVYCRLLVEDILKYLLPATNSKSEIECVILREALAVQIHKSIQVASSPETMYKFIIYLSKAILQPSRR
PWKESITTAVRWVWHAFRILLITRGVPYFSTAWFQFYLKLFSQKDNVSSSDLTRWFFFYTLLYPWIALVSAFVAETMTLCCIVTIFYDKNVNRQWKQYILTSVSNMDKGNPSGGSQSTNVTTFRRFSQSSYPRRSNYRRRISTSSKSLYELSPSKFKSIPITSNPPPMLNLSKGSTSVEPTFCETNASVALSTVTSTPVFSTDSSPLSSRTRENLLSLIPSAVSSPTKANTNKSHQRSFSIPKATKDSQTPSENSAATLKQAAIDAYSQIPVIPFFLPSDKLIMLVESEYRNKHIFYSLLNSFTMVMFPELRHTK
Recombinant SPCC576.19c is typically produced in E. coli and tagged with histidine (His) to facilitate purification . Schizosaccharomyces pombe can be used as a host for the expression and purification of eukaryotic proteins, offering post-translational modifications that are critical for the structure and function of eukaryotic proteins .
KEGG: spo:SPCC576.19c
STRING: 4896.SPCC576.19c.1
For initial characterization of SPCC576.19c, a multidimensional biochemical prefractionation approach followed by LC ESI MS/MS analysis is highly recommended. This methodology has successfully identified approximately 30% of the theoretical fission yeast proteome and would be appropriate for uncharacterized proteins . Begin with total cell lysate from wild-type fission yeast cells growing vegetatively in mid-log phase in rich media. Fractionate the lysate using preparative isoelectric focusing on immobilized pH gradients, one-dimensional gel electrophoresis, and strong ion-exchange chromatography. Subsequently analyze individual fractions by LC ESI MS/MS to detect peptides corresponding to your protein of interest .
When designing genetic experiments to study SPCC576.19c function:
First, create deletion strains using homologous recombination techniques to generate a SPCC576.19c knockout.
Perform comparative phenotypic analysis between wild-type and knockout strains under various growth conditions.
Consider tetrad analysis to study potential meiotic functions, as S. pombe is well-suited for studying meiotic recombination .
Implement both random spore and tetrad analyses to examine potential effects on intragenic recombination (gene conversion), intergenic recombination (crossing-over), and spore viability .
Remember that S. pombe has only three chromosomes and produces many viable meiotic products (spores) even when recombination-deficient, which facilitates analysis of mutations affecting meiotic recombination .
S. pombe offers several significant advantages for studying uncharacterized proteins:
Ease of genetic manipulation and the ability to analyze many independent meioses (>10^8) in a single experiment .
Production of viable meiotic products (spores) even in recombination-deficient strains, with 10-20% viability compared to wild type .
Availability of isogenic strains, facilitating exchange of alleles and comparison of results between different laboratories .
Representation of metazoan "core" proteins at a higher rate (47%) compared to the entire proteome (30%), suggesting conservation of essential protein functions across species .
Well-established methodologies for both transcriptomic and proteomic analyses, enabling multi-omics approaches to protein characterization .
When faced with contradictory findings about SPCC576.19c function, implement a systematic approach to experimental design:
Table 1: Framework for Resolving Contradictory Findings
| Contextual Category | Examples | Experimental Approach |
|---|---|---|
| Internal to cell system | Cell cycle stage, genetic background | Synchronize cultures, use isogenic strains |
| External to cell system | Growth media, temperature | Standardize conditions across experiments |
| Endogenous/exogenous factors | Protein modifications, environmental stress | Test under multiple defined conditions |
| Known controversy | Conflicting literature | Replicate both methodologies side-by-side |
| Methodological differences | Detection techniques | Apply multiple orthogonal techniques |
For effective quantification of SPCC576.19c expression levels, a label-free quantification approach based on spectral counts normalized to the number of predicted tryptic peptides is recommended . This method has successfully quantified 1465 proteins in S. pombe and shown considerable correlations with mRNA levels .
The methodology should include:
Extensive biochemical prefractionation of total cell lysate from wild-type fission yeast cells.
Analysis of individual fractions by liquid chromatography coupled with electrospray ionization tandem mass spectrometry (LC ESI MS/MS).
Statistical modeling to normalize spectral counts to the number of predicted tryptic peptides.
Comparative analysis with transcriptomic data to assess mRNA-protein correlation .
For comprehensive coverage, combine multiple prefractionation techniques, as individual techniques contribute differently to total protein detection .
To determine if SPCC576.19c participates in protein complexes:
Implement co-immunoprecipitation studies using tagged versions of SPCC576.19c, followed by mass spectrometry to identify interacting partners.
Perform functional pathway analysis of expression data, as proteins involved in complexes often cluster in groups with similar mRNA-protein ratios .
Use self-organizing map clustering of large-scale protein and mRNA data to reveal coordinate expression of components of functional pathways and protein complexes .
Consider that the mRNA-protein correlation tends to be increasingly discordant for components of protein complexes compared to proteins involved in signaling and metabolic processes .
Apply blue native PAGE or size-exclusion chromatography to isolate intact protein complexes.
To determine if SPCC576.19c is essential:
Create heterozygous diploid deletion strains using homologous recombination, then induce sporulation and analyze tetrad dissection patterns .
Implement a conditional expression system (e.g., using the nmt1 promoter) that allows regulated expression of SPCC576.19c.
Consider that essential and non-essential proteins are equally represented (36%) in proteomic studies of S. pombe, which aids in comparative analysis .
Use tetrad analysis to thoroughly examine spore viability patterns, which can distinguish between essential and non-essential genes .
Implement a CRISPR-Cas9 approach with inducible guide RNAs as an alternative genetic manipulation strategy.
For comprehensive analysis of post-translational modifications (PTMs):
Implement enrichment strategies specific to the PTM of interest (e.g., phosphopeptide enrichment for phosphorylation).
Use high-resolution mass spectrometry with electron transfer dissociation (ETD) or higher-energy collisional dissociation (HCD) fragmentation methods.
Apply multiple proteases beyond trypsin (e.g., chymotrypsin, AspN) to increase sequence coverage.
Consider that the correlation between mRNA and protein levels might be affected by PTMs, particularly for regulatory proteins .
Compare PTM patterns across different growth conditions and genetic backgrounds to identify functional significance.
To determine the subcellular localization of SPCC576.19c:
Generate GFP-tagged fusion constructs at either N- or C-terminus, ensuring preservation of protein function.
Perform live-cell imaging using confocal microscopy across different cell cycle stages.
Use co-localization studies with known organelle markers to precisely identify subcellular compartments.
Consider proteomics fractionation data, as previous studies undersampled proteins containing predicted transmembrane domains (14%) and likely membrane-associated proteins .
Implement immunogold electron microscopy for higher-resolution localization studies if antibodies are available.
For effective comparative analysis with orthologous proteins:
Apply self-organizing map clustering of large-scale protein and mRNA data from fission and budding yeast to reveal coordinate but not always concordant expression patterns .
Consider that S. pombe-specific proteins are represented at the same rate (30%) as the entire proteome in proteomic studies .
Recognize the considerable divergence in gene expression patterns between fission yeast and budding yeast observed in previous transcriptomic studies and confirmed at the protein level .
Perform sequence and structural homology analyses to identify conserved functional domains.
Compare phenotypes of deletion mutants across yeast species to identify conserved functional roles.
The most effective bioinformatic tools for function prediction include:
Sequence homology tools (BLAST, HMMER) to identify distant relatives and conserved domains.
Structural prediction algorithms (AlphaFold, RoseTTAFold) to generate protein structure models.
Gene neighborhood analysis to identify functional associations based on genomic context.
Co-expression network analysis using the extensive proteomic and transcriptomic datasets available for S. pombe .
GO term enrichment analysis of interacting partners to infer potential biological processes.
For effective integration of transcriptomic and proteomic data:
Recognize that mRNA-protein correlation is strong for proteins involved in signaling and metabolic processes but increasingly discordant for components of protein complexes .
Use label-free quantification approaches normalized to predicted tryptic peptides to accurately quantify protein levels .
Apply functional pathway analysis to categorize genes/proteins based on their mRNA-protein correlation patterns .
Implement self-organizing map clustering to identify coordinate expression patterns .
Consider that the correlation between mRNA and protein abundance may vary depending on the cellular context and experimental conditions.
To resolve contradictions in the literature:
Categorize the contradictions based on contextual characteristics: internal to the patient/organism, external to the patient/organism, endogenous/exogenous factors, known controversies, or methodological differences .
Examine the detailed experimental conditions used in each study, as subtle differences can significantly impact results.
Consider that automated text analysis techniques can help extract claims from the literature and flag potentially contradictory findings .
Implement a systematic approach to experimental design that specifically addresses the identified contradictions .
Collaborate directly with the research groups reporting contradictory findings to resolve methodological differences.
For validating protein-protein interactions:
Use multiple orthogonal approaches: co-immunoprecipitation, yeast two-hybrid, bimolecular fluorescence complementation, and proximity labeling.
Perform reciprocal tagging experiments to confirm interactions from both directions.
Validate interactions under native expression conditions rather than relying solely on overexpression systems.
Consider that proteins involved in complexes often show similar mRNA-protein ratio patterns .
Implement quantitative interaction proteomics using SILAC or TMT labeling to differentiate specific from non-specific interactions.
To investigate potential roles in meiotic recombination:
Generate SPCC576.19c deletion strains and assess effects on spore viability, as S. pombe produces viable meiotic products even in recombination-deficient strains .
Implement genetic assays of intragenic recombination (gene conversion), intergenic recombination (crossing-over), and spore viability .
Perform both random spore and tetrad analyses to comprehensively characterize recombination phenotypes .
Consider that S. pombe has only three chromosomes, which facilitates the analysis of recombination defects .
Compare phenotypes with known recombination mutants to position SPCC576.19c in the established pathway of meiotic recombination for S. pombe .