Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16 (SPCC794.16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPCC794.16; Putative uncharacterized protein SPCC794.16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC794.16
Target Protein Sequence
MQLNRSNKNLARRNVPYSKVFYLHSLKTSVRTKRINLKNIHSYLNAENCNDKKNFFFLSK TISFTNFVASNHLNKKIPIRLDKLNGLTLLTKKNFFFFFFFFTTITYSQSLRYTLLLIVF LFF
Uniprot No.

Q&A

What is the amino acid sequence of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16, and what structural implications does it have?

The amino acid sequence of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16 (SPCC794.16) is: MQLNRSNKNLARRNVPYSKVFYLHSLKTSVRTKRINLKNIHSYLNAENCNDKKNFFFLSKTISFTNFVASNHLNKKIPIRLDKLNGLTLLTKKNFFFFFFFFTTITYSQSLRYTLLLIVFLFF . This 123-amino acid sequence (Expression Region: 1-123) contains multiple lysine residues and a relatively high percentage of phenylalanine, particularly in the C-terminal region. The sequence suggests potential membrane association due to the presence of hydrophobic residues in the C-terminal portion. When designing experiments, researchers should consider that the structural properties of this protein might affect solubility and interaction with other cellular components. For structural studies, it is advisable to use prediction algorithms to estimate secondary structure elements before proceeding with experimental validation through circular dichroism or NMR spectroscopy.

What are the optimal storage conditions for maintaining the stability and activity of this recombinant protein?

For Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16, the recommended storage conditions are -20°C for standard storage, and -20°C to -80°C for extended storage periods . The protein is supplied in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . To maintain protein integrity during experimental workflows, it is crucial to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity. Instead, prepare working aliquots and store them at 4°C for up to one week . For experiments requiring longer storage at 4°C, conduct stability assays to determine activity retention over time. When designing long-term studies, implement a quality control protocol that periodically verifies protein integrity through techniques such as SDS-PAGE, Western blot, or activity assays depending on the protein's known functions.

How should researchers validate the identity and purity of the recombinant protein before experimental use?

A multi-method validation approach is recommended for confirming the identity and purity of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16. Begin with SDS-PAGE analysis to verify molecular weight (expected size based on the 123 amino acids plus any tag) and assess gross purity. Follow with Western blotting using antibodies against either the protein itself or any tags present in the recombinant construct. For higher confidence in protein identity, mass spectrometry analysis (MALDI-TOF or LC-MS/MS) should be performed to confirm the amino acid sequence. Purity should be quantitatively assessed through densitometry of SDS-PAGE gels or HPLC analysis. Additionally, because this is a putative uncharacterized protein, researchers should consider circular dichroism to verify that the protein maintains proper folding. Document all validation results in a standardized format as shown in Table 1, which enables comparison across batches and ensures experimental reproducibility.

Table 1. Recommended Validation Parameters for Recombinant SPCC794.16 Protein

Validation MethodParameterAcceptable RangePurpose
SDS-PAGEMolecular weightExpected MW ± 5%Identity confirmation
SDS-PAGEPurity>95%Quality assurance
Western BlotBand detectionSingle band at expected MWSpecificity verification
Mass SpectrometrySequence coverage>80%Sequence confirmation
Circular DichroismSecondary structureConsistent with predictionFolding verification
Dynamic Light ScatteringAggregation stateMonodisperseSolution behavior

What statistical design approach is most appropriate for optimization experiments involving Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16?

For protein interaction studies with SPCC794.16, researchers might examine factors such as pH, temperature, salt concentration, and reducing agent concentration. Using Taguchi's orthogonal design would allow simultaneous optimization of these conditions while performing fewer experiments than exhaustive approaches. This methodology enables identification of not only optimal conditions but also the significance and sensitivity of each parameter , providing deeper insight into the protein's biochemical behavior. Statistical software should be utilized to generate the experimental layout and analyze the results, with attention to potential interactions between factors that might affect protein function or stability.

How should researchers address missing data challenges in experiments involving this uncharacterized protein?

When conducting experiments with Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16, missing data can introduce significant bias if not properly addressed. Researchers should implement both preventive and analytical strategies. Preventively, design experiments with adequate controls and replicates, and standardize protocols to minimize technical failures. For analytical approaches, begin by documenting the pattern and extent of missingness. Create a modified Table 1 in your research report that compares observations with and without missing data (partial versus complete cases) to assess whether measured variables are associated with missingness .

What considerations should researchers address when designing interaction studies with this putative uncharacterized protein?

When designing interaction studies for Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16, researchers must address several critical considerations due to its uncharacterized nature. First, employ multiple complementary interaction detection methods (e.g., co-immunoprecipitation, yeast two-hybrid, biolayer interferometry) to increase confidence in results and minimize method-specific artifacts. Second, carefully consider the tag used during protein production, as it may affect interactions—compare studies using N-terminal versus C-terminal tags, or utilize tag-free protein through precision proteolytic removal if feasible.

Third, design experiments to distinguish direct from indirect interactions by including appropriate controls and stepwise binding assays. Fourth, consider the native cellular environment of S. pombe when selecting buffer conditions for in vitro studies, particularly regarding pH, salt concentration, and relevant cofactors. Fifth, apply statistical design principles like factorial approaches to systematically evaluate how different conditions affect interaction parameters. Finally, validate any identified interactions through orthogonal approaches such as mutational analysis of predicted binding sites or competitive binding studies. Document all interactions using standardized formats that include quantitative affinity measurements (KD values), stoichiometry information, and environmental dependencies to facilitate comparison across studies of this poorly characterized protein.

How can researchers effectively employ the Taguchi method for optimizing expression and purification of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16?

For optimizing expression and purification of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16, researchers should implement Taguchi's DoE methodology through a systematic, stepwise approach. Begin by identifying key controllable factors affecting expression and purification, such as induction time, temperature, inducer concentration, lysis buffer composition, and purification column conditions. Based on literature and preliminary experiments, select appropriate levels for each factor. For a comprehensive yet efficient analysis, utilize an L16 orthogonal array design, which allows evaluation of multiple factors simultaneously while minimizing the number of experimental runs .

Conduct experiments according to the design matrix, measuring response variables such as protein yield, purity, and functional activity. Analyze results using signal-to-noise ratios and analysis of variance (ANOVA) to determine each factor's significance and optimal levels. ANOVA will identify which parameters significantly influence the targeted outputs (yield, purity, activity) and quantify their relative importance . This approach enables not only identification of optimal conditions but also understanding of the sensitivity of each parameter, allowing for robust protocol development. Finally, conduct confirmation experiments under the predicted optimal conditions to validate the model's accuracy. This structured approach provides a statistically sound basis for protocol optimization while conserving valuable research resources compared to conventional one-factor-at-a-time methods.

What approaches should be used to investigate potential functional roles of this putative uncharacterized protein?

Investigating the functional roles of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16 requires a multi-faceted approach combining computational prediction, biochemical characterization, and genetic analysis. Begin with comprehensive bioinformatic analysis, including sequence homology searches against characterized proteins, domain prediction, subcellular localization prediction, and structural modeling. These predictions should guide initial biochemical characterization focusing on predicted activities (enzymatic assays, binding studies, etc.). For in vivo functional investigation, implement CRISPR-Cas9 gene editing to create knockout and tagged strains in S. pombe, followed by phenotypic characterization under various stress conditions.

For interaction network analysis, perform immunoprecipitation coupled with mass spectrometry (IP-MS) to identify protein binding partners, and validate key interactions using reciprocal co-IP or proximity labeling techniques. Transcriptomics analysis comparing wild-type and knockout strains can reveal affected pathways, while phosphoproteomics or other post-translational modification analyses may identify regulatory mechanisms. For each experimental approach, implement appropriate statistical analyses and controls. Integrate findings from these complementary approaches to develop a coherent functional model, which should then be validated through targeted experiments testing specific hypotheses about protein function. This comprehensive strategy maximizes the likelihood of accurately characterizing this previously uncharacterized protein while minimizing false discoveries.

How should researchers properly design and report studies involving site-directed mutagenesis of this protein?

When conducting site-directed mutagenesis studies of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16, researchers should implement a systematic approach from design through reporting. Begin with rational selection of mutation sites based on sequence conservation analysis, structural predictions, and evolutionary data. Prioritize residues that may be functionally important, such as the conserved motifs or regions with predicted secondary structure. Design each mutation with a clear hypothesis about its potential impact, and include appropriate controls such as conservative and non-conservative substitutions at the same position.

For experimental design, employ Taguchi's fractional factorial approach to efficiently evaluate multiple mutations across several functional assays . This enables assessment of both individual mutations and potential interaction effects. Verification of each mutant should include sequence confirmation, expression level analysis, and basic folding assessment to ensure observed effects result from specific functional changes rather than gross structural perturbations.

When reporting results, adhere to the principles outlined for effective Table 1 construction , creating a comprehensive comparison table of wild-type and mutant properties. Include quantitative measures of protein stability (Tm values), activity parameters (kcat, Km), and interaction affinities where applicable. Present data in a standardized format that facilitates comparison across mutations and with other proteins in the same family. Include detailed methodological descriptions that enable reproducibility, with particular attention to buffer conditions and assay parameters that might influence mutant behavior.

What are the best practices for presenting comparative data between wild-type and mutant forms of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16?

When presenting comparative data between wild-type and mutant forms of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16, researchers should implement several best practices to ensure clarity and facilitate valid interpretation. Design your primary comparison table following the guidelines for an effective Table 1, which should include clearly defined columns for each protein variant and rows for key characteristics . For categorical variables, present data as percentages (rounded to whole numbers to reduce visual clutter), with the total sample size indicated in the column header . For continuous variables such as binding affinities or stability measurements, carefully consider whether mean with standard deviation or median with interquartile range better represents your data distribution .

Beyond basic table structure, incorporate elements that highlight both statistical and biological significance. Present p-values for key comparisons, but also include effect sizes to emphasize magnitude of differences. Use graphical representations as complements to tabular data, particularly for comparing kinetic parameters or stability curves across multiple variants. When reporting on multiple experiments or batches, include measures of inter-experimental variability to address reproducibility concerns. Finally, structure your presentation to clearly connect observed differences to their potential structural or functional implications, progressing from direct measurements (e.g., changes in secondary structure) to functional consequences (e.g., altered binding specificity). This approach provides readers with a comprehensive understanding of how specific mutations impact this uncharacterized protein.

How should researchers effectively present the experimental design and statistical analysis for studies of this protein in scientific publications?

When presenting experimental design and statistical analysis for studies of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16 in scientific publications, researchers should adopt a transparent, comprehensive approach that enables reproducibility and valid interpretation. Begin the methods section with a clear statement of the experimental design type (e.g., completely randomized, blocked, factorial) and justification for this choice. For complex designs such as Taguchi's orthogonal arrays, include the specific array used (e.g., L16) and the assignment of factors to columns .

Present a comprehensive table of experimental factors and their levels, similar to Table 1 in the Taguchi-based approach documentation . For the statistical analysis section, specify all statistical tests used, their assumptions, how these assumptions were verified, and any corrections applied for multiple comparisons. When reporting ANOVA results, include degrees of freedom, F-values, and exact p-values rather than threshold-based significance indicators .

For visual presentation of experimental design, consider using schematic diagrams similar to Figures 1 and 2 in the Taguchi methodology paper , which efficiently communicate the relationship between factors and response variables. When reporting results, include both main effects and interaction effects where applicable, with appropriate measures of effect size to complement p-values. Finally, include a section discussing limitations of the experimental design and statistical approach, particularly addressing any assumptions that might impact interpretation when working with this poorly characterized protein. This level of detail ensures that readers can fully evaluate the validity of findings and potentially replicate the work.

What information should be included in a comprehensive methods section for research involving this recombinant protein?

A comprehensive methods section for research involving Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16 should include several key components to ensure reproducibility. Begin with detailed protein production information, including the exact construct used (with accession numbers and any modifications from the native sequence), expression system specifications (strain, vector, promoter), and complete purification protocol with buffer compositions. Specify the tag type used (which may be determined during the production process for this protein) and whether it was removed for subsequent experiments.

Include precise storage conditions (Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage) and handling procedures to maintain stability, noting that repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week . Provide detailed quality control procedures used to verify protein identity, purity, and integrity before experimentation.

For experimental methods, describe all buffer components with exact concentrations, pH, and additives. Detail instrumentation used, including manufacturer, model, and calibration procedures. For statistical design, specify the experimental design approach (e.g., Taguchi's orthogonal array) , number of replicates, randomization procedure, and all analytical methods with validation parameters. Present the statistical analysis workflow, including software packages, versions, and specific tests with justification. This level of methodological detail is essential for ensuring that other researchers can reproduce and build upon findings related to this uncharacterized protein.

What are the most common technical challenges in working with Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16, and how can they be addressed?

Working with Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16 presents several technical challenges due to its uncharacterized nature. A common issue is protein aggregation during storage or experimental manipulation. To address this, implement a stepwise troubleshooting approach: first, verify proper storage in the recommended Tris-based buffer with 50% glycerol ; second, optimize buffer conditions by screening various pH values, salt concentrations, and stabilizing additives; third, consider using dynamic light scattering to monitor aggregation state under different conditions.

Another frequent challenge is inconsistent activity in functional assays. Address this by implementing rigorous quality control procedures before experiments, including SDS-PAGE for purity assessment, circular dichroism for structural integrity verification, and activity standardization against known controls. For expression and purification difficulties, apply Taguchi's fractional factorial design approach to systematically optimize conditions while minimizing experimental runs.

When encountering difficulties with protein-protein interaction studies, consider tag interference—test multiple tag positions or use tag-free protein through proteolytic removal. For all technical challenges, maintain a detailed laboratory notebook documenting exact conditions, observations, and troubleshooting steps. This systematic approach not only resolves immediate issues but also generates valuable methodological insights for the broader research community working with this and similar uncharacterized proteins.

How can researchers ensure reproducibility in experiments involving this putative uncharacterized protein?

Ensuring reproducibility in experiments involving Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16 requires implementation of multiple strategic approaches throughout the research process. Start with rigorous protein quality control by establishing and documenting batch-to-batch comparison protocols including SDS-PAGE, mass spectrometry, and activity assays. Create a standardized protein characterization sheet for each batch that includes purity percentage, specific activity, stability parameters, and aggregation state.

Develop detailed standard operating procedures (SOPs) for all experimental protocols, with explicit documentation of buffer compositions, incubation times, temperatures, and equipment settings. Implement internal validation steps within each protocol to verify that experimental conditions meet predetermined quality criteria before proceeding. For complex experiments, use statistical design principles such as Taguchi's approach to systematically evaluate parameter importance and establish robust protocols that account for critical variables.

Address the challenge of missing data by implementing preventive measures (adequate replicates, standardized workflows) and appropriate analytical strategies when missingness occurs . Establish clear criteria for excluding outliers and handling technical failures, documenting all decisions transparently. Maintain comprehensive records including raw data, analysis scripts, and detailed methods. Finally, consider pre-registering experimental designs for major studies to distinguish between hypothesis-testing and exploratory analyses. This multi-faceted approach maximizes the likelihood of obtaining reproducible results when working with this challenging uncharacterized protein.

What quality control parameters should be monitored across different batches of this recombinant protein to ensure experimental consistency?

To ensure experimental consistency across different batches of Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16, researchers should implement a comprehensive quality control program monitoring multiple parameters. First, assess physical characteristics including protein concentration (using multiple methods such as Bradford assay and UV absorbance), purity (via SDS-PAGE with densitometry analysis, targeting >95%), and aggregation state (using dynamic light scattering or size exclusion chromatography). Second, verify protein identity through peptide mass fingerprinting or LC-MS/MS analysis, with sequence coverage targets exceeding 80%.

Third, evaluate structural integrity using circular dichroism to compare secondary structure profiles between batches and against reference standards. Fourth, if functional assays have been developed, measure specific activity under standardized conditions to ensure batch-to-batch consistency in biological function. Fifth, assess stability parameters including thermal stability (melting temperature via differential scanning fluorimetry) and time-dependent activity retention under storage conditions.

Document all quality control data in a standardized batch record format as shown in Table 2, which facilitates rapid comparison across production lots. Establish acceptance criteria for each parameter based on initial characterization and experimental requirements. For parameters showing batch-to-batch variability, implement normalization strategies in downstream experiments. This systematic approach ensures that experimental outcomes reflect true biological phenomena rather than technical variability in protein preparations.

Table 2. Quality Control Parameters for Batch Comparison of Recombinant SPCC794.16

Quality ParameterMethodAcceptance CriteriaBatch 1Batch 2Batch 3
PuritySDS-PAGE with densitometry>95%97%96%98%
IdentityLC-MS/MS>80% sequence coverage85%83%87%
ConcentrationBradford assayWithin 10% of target1.05 mg/ml0.98 mg/ml1.02 mg/ml
Secondary structureCircular dichroismProfile matches referenceConsistentConsistentConsistent
Thermal stabilityDifferential scanning fluorimetryTm within 2°C of reference58.5°C57.9°C59.1°C
Aggregation stateDynamic light scattering>90% monodisperse95%93%94%

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.