Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C9E9.01 (SPAC9E9.01)

Shipped with Ice Packs
In Stock

Description

Characterization Techniques

While functional data remains limited, standard physicochemical methods are critical for assessing quality and folding:

Key Techniques

MethodPurposeExample Application
SDS-PAGEPurity assessment >85% purity confirmation
Size Exclusion Chromatography (SEC)Evaluates homogeneity and aggregation state Detects monomeric vs. oligomeric forms
Dynamic Light Scattering (DLS)Measures hydrodynamic radius and aggregation Identifies particle size distribution
Differential Scanning Fluorimetry (DSF)Determines thermal stability and unfolding kinetics Melting curves for folding analysis

Functional Insights and Related Proteins

SPAC9E9.01 is annotated as "uncharacterized," but genomic context suggests potential roles:

  • Genomic Proximity: Located near SPAC9E9.05, a protein implicated in sister chromatid cohesion regulation in fission yeast .

  • Structural Motifs: While no functional domains are annotated, the protein lacks conserved motifs (e.g., KEN box, FGF motif) found in related cohesion regulators like Sororin .

Research Applications

Despite limited functional data, SPAC9E9.01 serves as a tool for:

  1. Structural Biology Studies: Investigating folding dynamics via DSF or X-ray crystallography .

  2. Protein-Protein Interaction Screens: Testing interactions with cohesion factors (e.g., Pds5, STAG2) .

  3. Yeast Model System Development: Exploring gene deletion phenotypes in S. pombe .

Challenges in Characterization

  • Limited Functional Data: No published studies directly link SPAC9E9.01 to biological pathways .

  • Expression Challenges: Recombinant production may require optimization due to low solubility or aggregation issues .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPAC9E9.01; Putative uncharacterized protein C9E9.01
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC9E9.01
Target Protein Sequence
MADGLELSAELSVHTGTVTHTIFVYVFLGKSKRLKTFSDSNVGSVIKLEAGFAVWSRCEA ANGEWMEADNEDRCRLYQIYRESKLKEFARYNVLSRVNW
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe and why is it valuable as a model organism?

Schizosaccharomyces pombe (S. pombe) is a rod-shaped unicellular eukaryote commonly known as fission yeast. It has become an increasingly valuable model organism over the past 50 years due to its significant contributions to our understanding of eukaryotic cell cycle regulation. Unlike the budding yeast Saccharomyces cerevisiae, S. pombe shares more common features with human cells, including gene structures, chromatin dynamics, prevalence of introns, and control of gene expression through pre-mRNA splicing, epigenetic gene silencing, and RNAi pathways. These similarities make it an excellent "micromammal" model for investigating molecular and cellular processes fundamental to all eukaryotes .

What is known about the putative uncharacterized protein C9E9.01 (SPAC9E9.01)?

The SPAC9E9.01 is classified as a putative uncharacterized protein in the S. pombe genome. While specific functions remain to be fully elucidated, researchers approach its characterization through comparative genomics, analyzing conserved domains, and performing experimental analyses similar to those used for other S. pombe proteins. For uncharacterized proteins in S. pombe, researchers typically examine cellular localization, expression patterns under various conditions, and potential interactions with known cellular components to begin inferring function.

What experimental approaches are most suitable for initial characterization of SPAC9E9.01?

Initial characterization typically follows a systematic approach:

  • Sequence analysis and homology comparison across species

  • Expression profiling under different growth conditions

  • GFP tagging for localization studies (similar to approaches used for nucleoporins in S. pombe)

  • Gene disruption analysis to assess essentiality for vegetative growth

  • Phenotypic screening of deletion mutants for defects in cell cycle, stress response, or meiotic progression

Researchers should begin with bioinformatic analyses to identify conserved domains before moving to experimental validation of predicted functions.

How should I design experiments to determine if SPAC9E9.01 is essential for S. pombe viability?

To determine essentiality, follow this methodological approach:

  • Generate a heterozygous diploid deletion strain by replacing one copy of the gene with a selectable marker.

  • Induce sporulation and analyze tetrad dissection patterns:

    • 2:2 viable:non-viable segregation pattern indicates essentiality

    • 4:0 viable:non-viable pattern suggests non-essentiality

For conditional analysis, consider:

  • Creating a strain with the gene under control of a repressible promoter (e.g., nmt1)

  • Implementing an auxin-inducible degron system for rapid protein depletion

Examine colony growth, cell morphology, and viability after gene repression or protein degradation to assess the impact on cellular functions .

What is the recommended protocol for generating recombinant SPAC9E9.01 protein for in vitro studies?

For recombinant protein production, the following procedure is recommended:

  • Vector Selection and Cloning:

    • Clone the full-length or specific domains of SPAC9E9.01 into an appropriate expression vector (e.g., pET for E. coli, pGEX for GST-fusion)

    • Include a purification tag (His6, GST, or MBP) to facilitate isolation

  • Expression Systems Comparison:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid growth, high yield, economicalLimited post-translational modifications10-50 mg/L culture
Insect cellsBetter folding, some PTMsMore complex, higher cost5-20 mg/L culture
Yeast (S. cerevisiae)Natural PTMs, proper foldingLower yield than E. coli2-10 mg/L culture
Native (S. pombe)Authentic modificationsLowest yield, technically challenging0.5-5 mg/L culture
  • Purification Strategy:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Secondary purification using ion exchange or size exclusion chromatography

    • Assess purity using SDS-PAGE (target >85% purity)

  • Functional Validation:

    • Verify folding using circular dichroism or thermal shift assays

    • Develop activity assays based on predicted protein function

How can I design experiments to identify interaction partners of SPAC9E9.01?

To identify protein-protein interactions, implement a multi-faceted approach:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Tag SPAC9E9.01 with epitopes (e.g., FLAG, HA) expressed at endogenous levels

    • Perform immunoprecipitation followed by mass spectrometry

    • Include appropriate controls (untagged strains, GFP-only tags)

    • Apply stringent statistical analysis to differentiate specific from non-specific interactions

  • Yeast Two-Hybrid Screening:

    • Use SPAC9E9.01 as bait against an S. pombe cDNA library

    • Validate interactions using co-immunoprecipitation

    • Consider split-ubiquitin system for membrane-associated interactions

  • Proximity-Dependent Labeling:

    • Fuse SPAC9E9.01 with BioID or TurboID

    • Identify proximal proteins through biotinylation and streptavidin pulldown

    • Analyze proximity network using mass spectrometry

  • Data Integration:

    • Compare interaction data across multiple methods

    • Prioritize interactions found in multiple experimental approaches

    • Validate key interactions through reciprocal tagging experiments

How can I determine if SPAC9E9.01 is involved in RNAi pathways or heterochromatin formation in S. pombe?

S. pombe's RNAi machinery is essential for heterochromatin formation. To investigate SPAC9E9.01's potential role:

  • Genetic Interaction Analysis:

    • Cross SPAC9E9.01 mutants with known RNAi component mutants (dcr1Δ, ago1Δ, rdp1Δ)

    • Assess genetic interactions through tetrad analysis and growth phenotypes

    • Examine synthetic lethality or suppression relationships

  • Heterochromatin Integrity Assessment:

    • Analyze H3K9 methylation levels in centromeric regions using ChIP-seq

    • Measure silencing of reporter genes integrated into heterochromatic regions

    • Evaluate transcription of normally silenced repeat regions

  • siRNA Analysis:

    • Quantify siRNA levels derived from centromeric repeats

    • Compare siRNA profiles between wild-type and SPAC9E9.01 mutants

    • Assess impact on RNAi machinery localization to chromatin

  • Protein Association Studies:

    • Test for physical interactions with RITS complex (RNA-induced transcriptional silencing)

    • Examine co-localization with known heterochromatin factors like Swi6/HP1

What approaches can be used to study SPAC9E9.01's potential role in the cell cycle?

S. pombe is a powerful model for cell cycle studies. To investigate SPAC9E9.01's involvement:

  • Cell Cycle Synchronization:

    • Implement nitrogen starvation/release or cdc25-22 temperature shift protocols

    • Analyze protein expression, modification, and localization throughout the cell cycle

    • Compare wild-type and mutant cells for cycle progression differences

  • Checkpoint Response Analysis:

    • Expose cells to DNA damaging agents (HU, MMS, UV)

    • Measure checkpoint activation markers (Chk1 phosphorylation)

    • Assess cell cycle arrest capabilities in mutant strains

  • Cell Cycle Phase-Specific Functions:

    • Use phase-specific markers to identify execution point

    • Employ degron-tagged versions for phase-specific depletion

    • Analyze terminal phenotypes (elongation, septation defects)

  • High-Resolution Imaging:

    • Implement time-lapse microscopy with fluorescently tagged cell cycle markers

    • Quantify timing of cell cycle transitions

    • Measure specific cycle phases using septation index analysis

How can contradictory data about SPAC9E9.01 function be resolved through additional experiments?

When facing conflicting results:

  • Validate Genetic Background:

    • Sequence strain genomes to identify potential secondary mutations

    • Back-cross strains to isogenic wild-type to eliminate background effects

    • Use at least three independent genetic isolates for key experiments

  • Control for Experimental Conditions:

    • Standardize growth conditions (media composition, temperature, cell density)

    • Document batch effects and control for them in experimental design

    • Implement factorial experimental designs to identify interaction effects

  • Employ Complementary Methodologies:

    • Use orthogonal techniques to test the same hypothesis

    • Compare results from genetic, biochemical, and imaging approaches

    • Consider CRISPR-based approaches alongside traditional methods

  • Quantitative Analysis:

    • Apply rigorous statistical testing appropriate for data type

    • Use power analysis to ensure adequate sample sizes

    • Consider Bayesian approaches for integrating conflicting evidence

Could SPAC9E9.01 be involved in metabolic regulation similar to other characterized S. pombe proteins?

To investigate metabolic functions:

  • Growth Profiling:

    • Test growth in different carbon sources (glucose, glycerol, ethanol)

    • Assess nutritional requirements and auxotrophies

    • Measure growth rates under limiting nutrients

  • Metabolomic Analysis:

    • Compare metabolite profiles between wild-type and mutant strains

    • Focus on key metabolic nodes (TCA cycle intermediates, amino acids)

    • Examine changes under stress conditions

  • Chronological Lifespan:

    • Measure long-term survival in stationary phase

    • Assess if the protein affects NAD+-dependent processes

    • Examine potential connections to respiration and ROS production

  • Integration with Stress Response:

    • Test connections to Sty1 MAP kinase pathway activation

    • Examine interactions with Tor signaling components

    • Investigate oxidative stress response mechanisms

What experimental design would best determine if SPAC9E9.01 functions in nuclear transport or nuclear pore complexes?

Based on nuclear pore complex studies in S. pombe:

  • Localization Analysis:

    • Generate GFP-tagged fusion at endogenous locus

    • Perform co-localization with known nuclear pore markers

    • Use high-resolution microscopy to determine precise NPC association

  • Phenotypic Characterization:

    • Assess nucleocytoplasmic transport using reporter proteins

    • Examine nuclear envelope morphology by electron microscopy

    • Analyze mRNA export efficiency

  • Interaction Mapping:

    • Perform immunoprecipitation with known nucleoporins

    • Map precise interaction domains through truncation analysis

    • Determine stoichiometry in the NPC using quantitative fluorescence

  • Functional Analysis:

    • Create conditional mutants and monitor acute effects on nuclear transport

    • Examine genetic interactions with established transport factors

    • Assess impact on specific cargo classes (proteins, RNAs)

What are the most effective CRISPR-Cas9 strategies for manipulating SPAC9E9.01 in S. pombe?

CRISPR-Cas9 implementation in S. pombe requires specific considerations:

  • gRNA Design:

    • Select target sites with minimal off-target potential

    • Optimize for S. pombe codon usage

    • Validate efficacy using in silico prediction tools

  • Delivery Methods:

    • Use plasmid-based expression for transient manipulation

    • Integrate Cas9 and gRNA for stable editing

    • Consider ribonucleoprotein (RNP) delivery for reduced off-target effects

  • Repair Template Strategy:

    • Design long homology arms (500-1000 bp) for efficient homologous recombination

    • Include selectable markers for positive selection

    • Consider markerless strategies using negative selection

  • Validation Approaches:

    • Confirm edits by sequencing

    • Assess off-target effects through whole-genome sequencing

    • Verify protein loss through Western blotting or immunofluorescence

How can high-throughput approaches be applied to study SPAC9E9.01 function?

Implement scalable methodologies:

  • Synthetic Genetic Array (SGA) Analysis:

    • Cross SPAC9E9.01 mutant with genome-wide deletion collection

    • Identify genetic interactions through colony size measurements

    • Cluster genetic interaction profiles with known pathway components

  • Pooled CRISPR Screens:

    • Design sgRNA library targeting genes of interest

    • Use growth-based selection to identify genetic interactions

    • Apply barcode sequencing for quantitative readout

  • Proteome-wide Interaction Mapping:

    • Implement BioID approaches for proximity mapping

    • Use protein complementation assays in array format

    • Apply mass spectrometry for comprehensive interaction analysis

  • Transcriptome Analysis:

    • Compare RNA-seq profiles between wild-type and mutant strains

    • Identify differentially expressed genes under various conditions

    • Integrate with ChIP-seq data to connect direct and indirect effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.