Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C1235.18 (SPCC1235.18)

Shipped with Ice Packs
In Stock

Description

Introduction and Nomenclature

The Recombinant Schizosaccharomyces pombe Putative Uncharacterized Transmembrane Protein C1235.18 (SPCC1235.18) is a laboratory-produced version of a hypothetical protein encoded by the SPCC1235.18 gene in the fission yeast Schizosaccharomyces pombe. While its biological function remains undefined, it is classified as a transmembrane protein due to predicted structural features . The protein is also referred to as "hypothetical protein SPCC1235.18" in genomic databases, reflecting its uncharacterized status .

Production and Purification

SPCC1235.18 is synthesized via recombinant DNA technology, with multiple expression systems employed:

Host SystemPurityApplicationsSource
E. coli>85% (SDS-PAGE)Biochemical assays, antibody productionMyBioSource, Cusabio
Yeast>85% (SDS-PAGE)Cell-free expression, structural studiesCusabio
Baculovirus>85% (SDS-PAGE)Post-translational modification studiesCusabio
Mammalian cells>85% (SDS-PAGE)Functional assays, interaction studiesCusabio

Key Features:

  • Partial Sequence: Available recombinant proteins often include only fragments of the full-length protein (e.g., residues 1–159) .

  • Tagging: AviTag biotinylation is used in some preparations for enhanced detection .

  • Storage: Lyophilized forms are stable for 12 months at -20°C/-80°C, while liquid stocks require aliquoting and storage at -20°C/-80°C to prevent degradation .

Biochemical Properties

Unresolved Questions:

  • Biological Role: No experimental evidence links SPCC1235.18 to specific pathways (e.g., DNA replication, stress response).

  • Subcellular Localization: Confirmed membrane association remains unverified.

  • Interactome: Potential partners in S. pombe networks are unknown.

Opportunities:

  • Genetic Screens: Deletion mutant studies to assess phenotypic effects.

  • CRISPR-Cas9 Editing: Knockout models to study essentiality.

  • Proteomic Profiling: Co-IP/mass spectrometry to identify interacting proteins .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPCC1235.18; Putative uncharacterized transmembrane protein C1235.18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC1235.18
Target Protein Sequence
MTPRNPSNYDSLFDSSIFSSTLFSSSLYHSAFDCSFGISFTIQPPIEYIVLSKPCFFAIT PLLTLRCNGIAWHDSLDMTIWVSTVTSLPISHCLIVSLSLSHAFPSLFYSALVLSCLSLL CLAFTPRIPFHLHSVVCSYFGRECLSPLFPSPYFTCHNG
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the fundamental structural characteristics of SPCC1235.18?

The SPCC1235.18 protein is a putative uncharacterized transmembrane protein in Schizosaccharomyces pombe with predicted membrane-spanning domains. While specific structural data is limited due to its uncharacterized status, researchers can employ various methodologies to elucidate its structure. Bioinformatic analysis combining hydrophobicity plotting and transmembrane prediction algorithms can provide preliminary structural insights. These computational approaches should be followed by experimental verification through techniques such as circular dichroism spectroscopy to determine secondary structure elements, and if possible, X-ray crystallography or cryo-electron microscopy for tertiary structure determination. For membrane proteins like SPCC1235.18, detergent solubilization optimization is critical before attempting structural studies .

How can SPCC1235.18 be effectively expressed in recombinant systems?

Expression of SPCC1235.18 requires careful optimization of expression systems. For recombinant expression, researchers should consider using either homologous (S. pombe) or heterologous (E. coli, insect cells, or mammalian cells) systems depending on research objectives. When using E. coli, specialized strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) often yield better results. Expression vectors incorporating solubility tags (MBP, SUMO, or TrxA) can enhance protein folding and stability. Critical parameters to optimize include induction temperature (typically lowered to 16-18°C for membrane proteins), inducer concentration, and duration of expression. Post-expression analysis should involve Western blotting to confirm expression and proper membrane localization through cellular fractionation .

What chronological lifespan assays can be used to study S. pombe strains expressing modified SPCC1235.18?

When investigating the potential role of SPCC1235.18 in cellular longevity, researchers can implement the chronological lifespan (CLS) assay specifically developed for S. pombe. This methodology monitors cell viability in culture over time, showing a continuous decline in viability without detectable regrowth until all cells are dead. This approach allows monitoring of the entire lifespan until viable cell numbers decrease over 10^6-fold. The assay can evaluate how modifications to SPCC1235.18 might influence longevity pathways in different nutritional conditions. Researchers should implement both normal nutrition and caloric restriction conditions when testing SPCC1235.18 mutants, as these conditions have demonstrated differential effects on S. pombe longevity pathways. Proper implementation of this assay requires rigorous cell viability measurements at regular intervals and can reveal connections between membrane protein function and cellular aging processes .

Nutrition ConditionWild-type CLS (days)Potential Effect of SPCC1235.18 ModificationKey Measurements
Over nutrition14-16May shorten or extend lifespanCell viability, stress resistance markers
Normal nutrition18-22Variable depending on modificationCell viability, cell cycle exit efficiency
Caloric restriction30-35May enhance longevity effectsCell viability, stress response genes

How should researchers design experiments to identify SPCC1235.18 interaction partners?

To identify interaction partners of SPCC1235.18, researchers should implement a multi-faceted approach combining in vivo and in vitro techniques. Begin with affinity purification coupled with mass spectrometry (AP-MS) using tagged versions of SPCC1235.18 expressed at endogenous levels. For membrane proteins like SPCC1235.18, chemical crosslinking prior to lysis can stabilize transient interactions. Complementary approaches include yeast two-hybrid screening with the soluble domains of SPCC1235.18, or split-ubiquitin assays if working with the full-length protein. Proximity-based labeling methods such as BioID or APEX2 are particularly valuable for transmembrane proteins, as they can capture both stable and transient interactions in the native cellular environment. All potential interactions should be validated through reciprocal co-immunoprecipitation and functional assays to eliminate false positives .

What are the recommended approaches for generating SPCC1235.18 mutants in S. pombe?

Creating targeted mutations in SPCC1235.18 requires precise genetic engineering approaches optimized for S. pombe. CRISPR-Cas9 systems adapted for fission yeast provide the most efficient method for generating point mutations, deletions, or insertions. When designing guide RNAs, researchers should avoid transmembrane regions which may have lower accessibility. For systematic analysis, consider creating an alanine-scanning library targeting conserved residues, particularly those in predicted functional domains or loops. Homologous recombination-based approaches using antibiotic resistance markers remain effective for complete gene deletions. All mutants should be verified through sequencing and expression analysis via Western blotting. When characterizing mutants, researchers should assess both localization (using fluorescent protein fusions) and function through phenotypic assays relevant to membrane protein activity, such as stress response, growth rate analysis, and subcellular fractionation to confirm proper membrane integration .

How can researchers distinguish between direct and indirect effects when studying SPCC1235.18 function?

Distinguishing direct from indirect effects of SPCC1235.18 manipulation requires carefully designed experimental controls. Implement acute protein depletion systems like auxin-inducible degrons rather than relying solely on genetic knockouts, which may trigger compensatory mechanisms. Time-resolved analyses following protein depletion can help separate immediate (likely direct) from delayed (possibly indirect) effects. For suspected protein-protein interactions, in vitro reconstitution with purified components provides strong evidence for direct interactions. When analyzing transcriptional responses to SPCC1235.18 manipulation, compare rapid changes (0-30 minutes post-intervention) with later changes to differentiate primary from secondary effects. Complementation experiments using wild-type SPCC1235.18 or specific mutants can confirm the specificity of observed phenotypes. Finally, epistasis analysis with known pathway components can place SPCC1235.18 within cellular signaling frameworks and clarify its position in regulatory cascades .

What specialized membrane protein purification protocols are most effective for SPCC1235.18?

Purification of SPCC1235.18 requires membrane protein-specific protocols that preserve native structure and function. Begin with optimizing membrane solubilization by screening multiple detergents (DDM, LMNG, digitonin) at various concentrations and temperature conditions. For transmembrane proteins like SPCC1235.18, gentle solubilization at 4°C for extended periods often yields better results than harsh, rapid extraction. Implement a two-step purification strategy combining affinity chromatography (using a tag that minimally impacts function) followed by size exclusion chromatography to achieve high purity. Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) as alternatives to traditional detergent micelles for maintaining a more native-like lipid environment. Post-purification quality assessment should include SDS-PAGE, Western blotting, and functional assays if available. For structural studies, thermal stability assays can identify buffer conditions that maximize protein stability during subsequent analyses .

How can researchers apply neutron reflectometry to study SPCC1235.18 membrane integration?

Neutron reflectometry (NR) represents a powerful technique for analyzing the membrane integration and orientation of transmembrane proteins like SPCC1235.18. This approach can reveal the precise positioning of protein domains relative to the lipid bilayer. When designing NR experiments, researchers should prepare highly purified SPCC1235.18 reconstituted into supported lipid bilayers on silicon wafers. Contrast variation experiments using different H2O/D2O ratios are essential for distinguishing between protein and lipid components. Analysis of scattering length density (SLD) profiles can provide detailed information about protein penetration depth, orientation, and conformational changes upon interaction with other proteins or ligands. The technique is particularly valuable for monitoring dynamic processes such as protein insertion into membranes or conformational changes in response to environmental conditions. Researchers should correlate NR findings with complementary techniques such as atomic force microscopy or cryo-electron microscopy to build comprehensive structural models .

What approaches can resolve contradictory data in SPCC1235.18 localization studies?

When faced with contradictory localization data for SPCC1235.18, researchers should implement a systematic troubleshooting and validation strategy. Begin by comparing detection methods—fluorescent protein tagging may cause mislocalization while antibody-based detection might suffer from specificity issues. Verify tag position effects by creating both N- and C-terminal fusion constructs, as well as internal tagging at predicted loop regions. For definitive localization, combine multiple approaches including subcellular fractionation, immunogold electron microscopy, and live-cell imaging under various physiological conditions. Cell cycle-dependent localization should be assessed through synchronized cultures or single-cell time-lapse microscopy. Artifacts may arise from overexpression, so researchers should prioritize endogenous tagging approaches that maintain native expression levels. Cross-validation with proteomics data from purified organelles can provide additional support for specific localizations. Finally, functional assays specific to the proposed localization sites can help resolve conflicting data by connecting localization with biological activity .

How can researchers determine if SPCC1235.18 functions in stress response pathways?

To investigate SPCC1235.18's potential role in stress response pathways, implement a systematic stress sensitivity profiling approach. Create deletion mutants or conditional expression strains of SPCC1235.18 and subject them to multiple stressors including oxidative stress (H2O2, paraquat), heat shock, osmotic stress (sorbitol, NaCl), and nutrient limitation. Quantitative growth assays with automated plate readers can generate precise growth curves under each condition. Complement these phenotypic assays with molecular analysis including qRT-PCR of known stress response genes (e.g., those regulated by Sty1/Atf1) in wild-type versus mutant backgrounds. Phosphoproteomic analysis before and after stress induction can reveal if SPCC1235.18 undergoes stress-dependent post-translational modifications or influences signaling cascades. For in-depth functional characterization, epistasis analysis with known stress response pathway components can position SPCC1235.18 within regulatory networks. Finally, localization studies during stress conditions may reveal dynamic redistribution patterns suggestive of stress-specific functions .

Stress ConditionWild-type ResponseΔSPCC1235.18 Potential PhenotypesMolecular Readouts
Oxidative stressNormal growth curveAltered resistance/sensitivityPap1 localization, Atf1 phosphorylation
Heat shockTemporary growth arrestChanged recovery kineticsHsp gene expression
Nutrient limitationCell cycle exitDefective G0 entrySck1/Sck2 pathway activity
Osmotic stressAdaptive responseChanged cell volume regulationGlycerol accumulation, Sty1 activation

What methodologies can differentiate between transport and structural roles of SPCC1235.18?

Distinguishing between potential transport and structural roles of SPCC1235.18 requires targeted experimental approaches. For transport function assessment, implement fluorescent substrate accumulation assays using candidate molecules based on bioinformatic predictions of transporter specificity. Liposome reconstitution experiments with purified SPCC1235.18 can directly test transport capabilities in a controlled environment. If transport is confirmed, kinetic characterization should follow, determining parameters such as Km, Vmax, and substrate specificity. For structural roles, examine the impact of SPCC1235.18 deletion on membrane integrity using fluorescent dyes that only penetrate compromised membranes. Electron microscopy can reveal ultrastructural changes in cellular membranes in the absence of SPCC1235.18. Protein-protein interaction studies focusing on known structural membrane components can indicate scaffold functions. Create chimeric proteins by swapping domains with related proteins to determine which regions are responsible for either transport or structural functions .

How should researchers approach site-specific photo-cross-linking experiments for SPCC1235.18?

Site-specific photo-cross-linking represents a powerful approach for mapping interaction interfaces of transmembrane proteins like SPCC1235.18. Begin by creating a library of SPCC1235.18 variants incorporating the non-natural amino acid p-benzoyl-L-phenylalanine (BPA) using the suppressor tRNA method. Select residues based on conservation analysis, predicted functional domains, and membrane topology models. After expression and purification, incubate the BPA-incorporated SPCC1235.18 variants with potential interaction partners and activate cross-linking with UV irradiation (typically 365 nm for 15-30 minutes). Analyze cross-linked products via SDS-PAGE followed by Western blotting or mass spectrometry for partner identification. For transmembrane regions, optimize detergent conditions to maintain native interactions during cross-linking. Create a systematic cross-linking map by testing multiple positions throughout the protein sequence, focusing particularly on predicted loops and functional domains. This approach can reveal transient interactions that might be missed by traditional co-immunoprecipitation methods and can provide residue-level resolution of interaction interfaces .

How can researchers reconcile contradictory results in SPCC1235.18 functional studies?

When faced with contradictory results in SPCC1235.18 functional studies, implement a systematic investigation to identify sources of variation. Begin by examining experimental conditions such as growth media composition, temperature, cell density, and strain background, as S. pombe phenotypes can be highly condition-dependent. Genetic background effects should be controlled by performing experiments in multiple independently derived strains. For molecular inconsistencies, verify the specificity of reagents including antibodies and construct designs. Technological biases can be addressed by employing complementary methodologies to measure the same parameter. Meta-analysis approaches combining results from multiple laboratories may reveal patterns not evident in individual studies. Consider time-dependent effects, as some phenotypes may manifest only under specific temporal conditions or cell cycle stages. Finally, develop quantitative models that can integrate contradictory observations by accounting for context-dependent variables, potentially revealing emergent properties of complex biological systems .

What statistical approaches are most appropriate for analyzing SPCC1235.18 experimental data?

Statistical analysis of SPCC1235.18 experimental data requires careful consideration of experimental design and data characteristics. For comparative studies between wild-type and mutant strains, begin with power analysis to determine appropriate sample sizes for detecting meaningful biological differences. When analyzing growth phenotypes, mixed-effects models can account for both fixed (genotype, treatment) and random (biological replicate, plate position) factors. For time-course experiments such as chronological lifespan assays, survival analysis methods including Kaplan-Meier curves and Cox proportional hazards models are appropriate. High-dimensional data from proteomics or transcriptomics should be analyzed using methods that control for multiple testing (FDR correction) and dimensional reduction techniques (PCA, t-SNE) to identify patterns. For interaction studies, statistical frameworks that can distinguish specific from non-specific binding, such as SAINT (Significance Analysis of INTeractome), should be implemented. All analyses should include appropriate biological and technical replicates, with clear reporting of variability measures such as standard deviation or confidence intervals .

Experiment TypeRecommended Statistical ApproachKey ParametersVisualization Method
Growth phenotypesMixed-effects modelsFixed/random effects, post-hoc testsGrowth curves with confidence intervals
Lifespan assaysSurvival analysis (Log-rank test)Median/maximum lifespan, hazard ratiosKaplan-Meier plots
Protein interactionsSAINT analysisProbability scores, abundance correctionInteraction networks
LocalizationColocalization coefficientsPearson's/Mander's coefficientsScatter plots, intensity profiles
Multi-conditionANOVA with post-hoc testsF-statistics, p-values with correctionHeat maps, radar plots

How should researchers integrate SPCC1235.18 findings with broader S. pombe research literature?

Integrating SPCC1235.18 research findings with the broader S. pombe literature requires a multifaceted approach to contextualization. Begin by conducting comprehensive literature searches using both general (SPCC1235.18, S. pombe transmembrane proteins) and specific functional terms identified in your studies. Leverage computational tools like STRING, PomBase, and BioCyc to position SPCC1235.18 within known interaction networks and pathways. Compare phenotypes observed in SPCC1235.18 studies with those of other S. pombe genes to identify potential functional relationships through phenotypic similarity. For evolutionary context, analyze conservation patterns across related species, potentially revealing functional insights from better-characterized orthologs. Consider how SPCC1235.18 findings might connect to fundamental biological processes such as cell cycle regulation, stress response, or membrane organization that have been extensively studied in S. pombe. When preparing manuscripts, explicitly discuss how SPCC1235.18 results confirm, challenge, or extend existing paradigms in S. pombe biology. Finally, develop testable hypotheses about SPCC1235.18 function based on integrated knowledge that can guide future research directions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.