Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C16E9.20 (SPBC16E9.20)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C16E9.20 (SPBC16E9.20) is a protein derived from the fission yeast Schizosaccharomyces pombe . This protein is tagged during production, although the specific tag type is determined during the production process . It is considered a putative uncharacterized transmembrane protein . The S. pombe genome has been extensively studied, with a significant portion of its proteome identified through mass spectrometry .

Function and Localization

As the name suggests, the function of SPBC16E9.20 is currently uncharacterized . The protein contains a transmembrane domain, implying it is likely located in a cellular membrane . Further research would be needed to elucidate its precise function and role within the cell.

Expression and Purification

S. pombe can be utilized as a host for expressing and purifying eukaryotic proteins . Expression vectors like pESP-1 and pESP-2 can facilitate protein production, and the glutathione S-transferase (GST) tag can be employed for protein purification .

Role in Schizosaccharomyces pombe

S. pombe serves as a model organism for studying eukaryotic biology . Large-scale studies have identified a substantial portion of the S. pombe proteome, offering a foundation for future research . Genetic studies in S. pombe have revealed insights into essential cellular processes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPBC16E9.20; Putative uncharacterized transmembrane protein C16E9.20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC16E9.20
Target Protein Sequence
MLVVVSLTPPVGVCVGLFHHLLSLGGGITTCITSMETGITKWSGSLRCNSQMQKEKGERK GKEEERKRGKEEKIWFHSKKMKIHDYCIVLYCILFYFYFVLILFYFIALYFILHPFYSTI LFFFPLFIKCSHLHTLTSFYSLLSSLFSSLIPKHSLHLAPLRKLNLSHFVSPLCAMFPHV GLRLLQTTQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant SPBC16E9.20?

For transmembrane proteins like SPBC16E9.20, the choice of expression system is critical. The following table compares the advantages and limitations of different expression systems:

Expression SystemAdvantagesLimitationsSuitability for SPBC16E9.20
Native S. pombeNatural folding environment, Post-translational modifications intactLower yield than heterologous systemsHigh - preserves native context
S. pombe with lsd90 promoter19-39 fold higher expression than standard promoters, Constitutive expressionOptimization may be requiredExcellent - specifically for this organism
E. coliRapid growth, High yield, Well-established protocolsLimited post-translational modifications, Membrane proteins often misfoldModerate - may require fusion partners
Pichia pastorisEukaryotic processing, High yield potentialInduction protocols can be complexGood - especially with AOX1 promoter

The lsd90 promoter-based vector system is particularly promising as it has been shown to provide constitutive expression at levels 19-fold higher than the nmt1 promoter, 39-fold higher than the adh1 promoter, and 10-fold higher than the AOX1 promoter in Pichia pastoris . This strong, constitutive promoter could significantly improve yields of recombinant SPBC16E9.20 for structural and functional studies.

What purification strategies overcome the challenges of transmembrane protein isolation?

Purification of transmembrane proteins requires specialized approaches:

  • Extraction method: For SPBC16E9.20, gentle detergent solubilization using non-ionic detergents (DDM, LDAO) is recommended to maintain native conformation.

  • Affinity tag selection: A C-terminal tag is advisable given the N-terminal position of the protein in the membrane. His6 or Strep-II tags generally have minimal impact on transmembrane protein function.

  • Purification workflow:

    • Membrane isolation via ultracentrifugation

    • Detergent solubilization optimization

    • Affinity chromatography

    • Size exclusion chromatography to improve purity and remove aggregates

  • Quality control checkpoints: Circular dichroism should be employed to verify secondary structure integrity after purification.

What genetic approaches can reveal the function of SPBC16E9.20?

Several genetic strategies can help elucidate the function of this uncharacterized protein:

  • Gene deletion/disruption: Constructing a SPBC16E9.20 knockout strain using homologous recombination or CRISPR-Cas9 systems to observe phenotypic effects. This approach requires careful phenotypic screening across diverse growth conditions.

  • Conditional expression systems: For essential genes, the use of tetracycline-regulated promoters or degron-based systems allows controlled depletion of the protein.

  • Synthetic genetic array (SGA) analysis: Systematic crossing of SPBC16E9.20 mutants with genome-wide deletion libraries to identify genetic interactions and potential functional pathways.

  • Complementation studies: Testing whether SPBC16E9.20 can functionally replace related proteins in other organisms may provide insights into conserved functions.

Each approach should be accompanied by appropriate controls to ensure the specificity of observed phenotypes.

What biochemical methods are recommended for investigating transmembrane protein interactions of SPBC16E9.20?

To identify protein interaction partners for SPBC16E9.20:

  • Proximity-based labeling approaches:

    • BioID or TurboID fusion proteins expressed in S. pombe can identify proximal proteins in their native environment

    • APEX2 fusion proteins allow for temporal control of labeling

  • Cross-linking mass spectrometry:

    • Chemical cross-linkers of varying arm lengths can capture transient interactions

    • Photo-activatable amino acid incorporation allows site-specific cross-linking

  • Co-immunoprecipitation with membrane-compatible detergents:

    • Digitonin, CHAPS, or DDM can maintain protein-protein interactions while solubilizing membranes

    • Tandem affinity purification (TAP) tags can improve specificity

  • Split-reporter systems:

    • Split-ubiquitin yeast two-hybrid specifically designed for membrane proteins

    • Bimolecular fluorescence complementation (BiFC) for visualizing interactions in vivo

These approaches should be validated through reciprocal experiments and controls with known non-interacting proteins.

How can researchers determine the structure of SPBC16E9.20 despite the challenges of transmembrane protein crystallization?

Determining the structure of transmembrane proteins like SPBC16E9.20 presents unique challenges:

  • Cryo-electron microscopy (cryo-EM):

    • Advantages: Does not require crystallization, can visualize proteins in different conformational states

    • Methodology: Protein must be purified to high homogeneity, typically requiring >100 μg of protein

    • Recent advances in direct electron detectors have improved resolution for smaller membrane proteins

  • X-ray crystallography:

    • Lipidic cubic phase (LCP) crystallization is specifically designed for membrane proteins

    • Fusion partners like T4 lysozyme or BRIL can aid crystallization by providing hydrophilic surfaces

    • Requires screening hundreds of conditions with varying detergents and lipids

  • NMR spectroscopy:

    • Solution NMR may be applicable given SPBC16E9.20's relatively small size (189 amino acids)

    • Requires isotopic labeling with 15N and 13C

    • Best for dynamic structural information and ligand binding studies

  • Integrative structural biology approaches:

    • Combining computational predictions, crosslinking data, and low-resolution experimental data

    • Methods like hydrogen-deuterium exchange mass spectrometry can provide valuable structural dynamics information

Each method requires optimization of detergent conditions to maintain protein stability while allowing for structural analysis.

How can the lsd90 promoter system be optimized for high-yield expression of SPBC16E9.20?

The lsd90 promoter offers significant advantages for expressing challenging proteins like SPBC16E9.20 in S. pombe:

  • Vector optimization:

    • The lsd90 promoter can be incorporated into vectors containing an ARS element (such as those corresponding to the mat2P flanking region) and a selectable marker (such as truncated URA3m)

    • Expression can be enhanced by including optimal Kozak context sequences before the start codon

  • Growth condition optimization:

    • Unlike nmt1 promoter that requires thiamine regulation, lsd90 provides constitutive expression in standard media

    • Expression levels with lsd90 have been documented at 19-fold higher than nmt1, 39-fold higher than adh1, and 10-fold higher than the AOX1 promoter in Pichia pastoris

  • Codon optimization:

    • Adapting the coding sequence to S. pombe preferred codons can further enhance expression

    • Special attention should be paid to rare codons in the target sequence

  • Leader sequence selection:

    • Different leader sequences can significantly impact expression levels and proper folding

    • Testing multiple leader sequences is advisable for optimal expression of transmembrane proteins

The effectiveness of the expression system can be monitored using reporter systems such as luciferase, which has been validated with the lsd90 promoter in previous studies .

What can phylogenetic analysis reveal about the evolutionary conservation of SPBC16E9.20?

Phylogenetic analysis of SPBC16E9.20 can provide insights into its evolutionary conservation and potential function:

  • Homology searching methodology:

    • Position-Specific Iterative BLAST (PSI-BLAST) is particularly effective for detecting distant homologs of transmembrane proteins

    • Hidden Markov Model (HMM) profiles can capture sequence patterns conserved across species

    • Transmembrane-specific alignment algorithms should be employed due to the distinct evolutionary constraints on membrane-spanning regions

  • Comparative analysis across fungal species:

    • Ortholog identification in related species like Saccharomyces cerevisiae may reveal functional information

    • Conservation patterns across the Schizosaccharomyces genus can highlight functionally important residues

    • Differential patterns of conservation in transmembrane versus loop regions can indicate functional domains

  • Analysis of selective pressure:

    • Ka/Ks ratio calculations can identify regions under purifying or positive selection

    • Amino acid substitution patterns specific to transmembrane regions should be considered using specialized substitution matrices

This evolutionary context may help researchers focus on the most conserved and potentially functionally significant regions of the protein for further experimental investigation.

What controls and validation experiments are essential when studying an uncharacterized protein like SPBC16E9.20?

Rigorous experimental design for studying SPBC16E9.20 should include:

  • Expression validation controls:

    • Western blot with tag-specific antibodies to confirm correct size and expression

    • Mass spectrometry validation of protein identity

    • Subcellular localization confirmation via fluorescent tagging or fractionation

  • Functional assay controls:

    • Positive controls using well-characterized transmembrane proteins from S. pombe

    • Negative controls using empty vectors or mutated/truncated versions of SPBC16E9.20

    • Rescue experiments to confirm phenotype specificity

  • Replication and statistical considerations:

    • Minimum of three biological replicates for all experiments

    • Appropriate statistical tests based on data distribution

    • Sample size calculations to ensure adequate power

  • Cross-validation approaches:

    • Multiple independent methods to confirm key findings

    • Orthogonal techniques to verify protein interactions or localization

    • Testing in different genetic backgrounds to rule out strain-specific effects

Thorough validation is particularly important for uncharacterized proteins to establish confidence in novel findings.

How can researchers leverage existing S. pombe research tools for studying SPBC16E9.20?

S. pombe has a rich set of research tools that can be applied to studying SPBC16E9.20:

  • Genome-wide resources:

    • The PomBase database contains comprehensive genomic and proteomic information

    • The S. pombe deletion library can be screened for genetic interactions

    • The ORFeome collection provides validated clones for many S. pombe genes

  • Cell cycle research connection:

    • Given S. pombe's strength as a cell cycle model, researchers should consider examining SPBC16E9.20 expression and function across the cell cycle

    • Temperature-sensitive mutants (similar to cdc20-P7 described in the literature) can be valuable tools for studying essential genes

    • FACS analysis can determine if disruption of SPBC16E9.20 affects cell cycle progression

  • S. pombe-specific techniques:

    • Pulsed-field gel electrophoresis for analyzing chromosomal DNA replication

    • Site-directed mutagenesis methods optimized for S. pombe genes

    • Integration at specific genomic loci such as the leu1 locus for stable expression

Leveraging these established tools allows researchers to place SPBC16E9.20 studies within the broader context of S. pombe biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.