Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C713.13 (SPBC713.13)

Shipped with Ice Packs
In Stock

Description

Expression and Production

SPBC713.13 is produced via recombinant expression in heterologous systems, with notable variations in host organisms and purification strategies:

ParameterE. coli/Yeast Expression Mammalian Cell Expression
HostE. coli or S. cerevisiaeMammalian cell lines
Purity≥85% (SDS-PAGE)≥85% (SDS-PAGE)
Sequence LengthFull (1–108 aa) or partialFull or partial
TagsN-terminal (e.g., GST, His)C-terminal (e.g., Fc, HA)
ApplicationsStructural studies, ELISA, Western blotFunctional assays, secretion studies

Recombinant SPBC713.13 is typically purified via affinity chromatography (e.g., nickel-NTA for His-tagged proteins) or ion-exchange methods .

Functional Insights and Research Applications

While SPBC713.13 lacks a defined role, interaction studies and genetic network analyses provide indirect clues:

  • Protein interactions: STRING database analysis identifies SPBC713.13 as a predicted partner of zas1 (zinc finger protein) and other uncharacterized proteins (e.g., SPBC713.14c) with interaction scores >0.6 . These associations suggest potential involvement in:

    • Membrane trafficking: Partnering with proteins like SPAC644.09 (PLP-binding protein) hints at roles in nutrient transport or metabolic regulation .

    • Stress response: Interactions with SPAC56F8.13/15 (uncharacterized proteins) may link SPBC713.13 to cellular stress pathways .

  • Genetic context: No direct functional studies on SPBC713.13 have been reported, but its genetic neighborhood (e.g., SPBC713.14c) implies conserved synteny in S. pombe .

Challenges in Production and Characterization

SPBC713.13, like other transmembrane proteins, poses challenges in recombinant production:

  • Low solubility: Hydrophobic transmembrane domains may require detergents (e.g., DDM) for solubilization .

  • Structural ambiguity: Absence from PDB_TM (a database of transmembrane proteins with resolved structures) indicates no high-resolution structural data .

  • Functional validation: Lack of enzymatic assays or phenotypic readouts complicates activity assessment .

Comparative Analysis of Recombinant Versions

Commercially available SPBC713.13 variants differ in formulation and utility:

Product CodeSupplierHostSequencePurityTagsApplications
MBS1024203MyBioSourceE. coli/YeastFull (1–108 aa)≥85%N-terminal (variable)ELISA, Western blot, structural studies
CSB-EP520745SXV1CusabioE. coliPartial>85%UnspecifiedELISA, protein interaction studies
CSB-YP520745SXV1CusabioYeastPartial>85%UnspecifiedFunctional assays, secretion studies

Note: Partial sequences may exclude critical transmembrane domains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPBC713.13; Putative uncharacterized transmembrane protein SPBC713.13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC713.13
Target Protein Sequence
MKIMKITNGNNLHYQTIYPYQMIPLSQPIAVFPPCYFVCFASLSISGRKHILFFNFFFFT FSTFFLLKCNFLKDIFLFFFLFFFFFLFTLFLSHPTLTGLPTFLCITH
Uniprot No.

Q&A

What is the biological significance of SPBC713.13 in Schizosaccharomyces pombe?

The protein SPBC713.13, annotated as a putative uncharacterized transmembrane protein in Schizosaccharomyces pombe, is believed to play a role in cellular processes that remain largely undefined. Transmembrane proteins are typically involved in cell signaling, transport, or structural functions within the membrane. In S. pombe, which serves as a model organism for eukaryotic biology, transmembrane proteins often participate in maintaining cellular homeostasis, responding to environmental stimuli, and mediating intracellular communication. The uncharacterized nature of SPBC713.13 suggests that its specific functions have not yet been elucidated through experimental studies, making it an intriguing target for further investigation .

Research into such proteins often begins with bioinformatic analyses to predict structural domains and potential functional motifs based on sequence homology. For SPBC713.13, computational tools could help hypothesize its role by identifying conserved regions that align with known protein families.

How can researchers experimentally verify the function of SPBC713.13?

To experimentally verify the function of SPBC713.13, researchers can employ a combination of genetic, biochemical, and cell biology approaches:

  • Gene Knockout or Knockdown Studies: Using CRISPR-Cas9 or RNA interference (RNAi), researchers can disrupt the gene encoding SPBC713.13 in S. pombe. Observing phenotypic changes in response to gene disruption can provide clues about its biological role.

  • Overexpression Systems: Cloning the gene into an expression vector and introducing it into S. pombe or a heterologous system allows researchers to study the effects of overexpression on cellular physiology.

  • Protein Localization Studies: Employing fluorescent tagging (e.g., GFP fusion) enables visualization of SPBC713.13 within cells to determine its subcellular localization.

  • Protein-Protein Interaction Assays: Techniques such as co-immunoprecipitation or yeast two-hybrid screening can identify interacting partners of SPBC713.13, shedding light on its functional pathways.

  • Functional Complementation: Introducing the SPBC713.13 gene into mutant strains lacking homologous proteins may reveal whether it can rescue specific phenotypes.

These approaches require careful experimental design to control for off-target effects and ensure reproducibility .

What challenges arise when studying uncharacterized transmembrane proteins like SPBC713.13?

Studying uncharacterized transmembrane proteins presents several challenges:

  • Structural Complexity: Transmembrane domains are hydrophobic and difficult to solubilize, complicating purification and structural analysis.

  • Functional Redundancy: Proteins with overlapping functions may mask phenotypic effects in knockout studies.

  • Lack of Homology: Limited sequence similarity with characterized proteins can hinder functional predictions.

  • Experimental Artifacts: Overexpression or tagging may alter protein behavior or localization.

To address these challenges, researchers often use advanced techniques such as cryo-electron microscopy for structural studies or mass spectrometry-based proteomics to identify interaction networks .

What bioinformatics tools are recommended for analyzing SPBC713.13?

Bioinformatics tools play a crucial role in characterizing unstudied proteins like SPBC713.13:

  • Sequence Analysis:

    • BLAST (Basic Local Alignment Search Tool) identifies homologous sequences in other organisms.

    • Pfam and SMART databases predict functional domains.

  • Structural Prediction:

    • AlphaFold provides high-confidence structural models based on sequence data.

    • TMHMM predicts transmembrane helices.

  • Functional Annotation:

    • STRING database identifies potential interaction networks.

    • GO (Gene Ontology) enrichment analysis links the protein to biological processes.

  • Phylogenetic Analysis:

    • MEGA software constructs evolutionary trees to trace homologs across species.

How does the recombinant expression system affect studies on SPBC713.13?

The choice of recombinant expression system significantly influences the study outcomes for SPBC713.13:

  • Host Organism: While S. pombe is ideal for studying native functions, heterologous systems like Escherichia coli or insect cells may be used for large-scale protein production.

  • Post-Translational Modifications (PTMs): Eukaryotic systems are preferred if PTMs such as glycosylation are critical for function.

  • Expression Levels: Overexpression can lead to misfolding or aggregation; optimizing expression conditions is essential.

  • Purification Tags: Fusion tags (e.g., His-tag) facilitate purification but may interfere with activity or localization.

Careful optimization of these parameters ensures that recombinant SPBC713.13 retains its native properties .

What experimental designs can elucidate the physiological role of SPBC713.13?

Experimental designs should integrate multiple approaches:

  • Phenotypic Screening:

    • Assess growth rates, stress responses, and morphological changes in mutants lacking SPBC713.13 under various conditions.

  • Omics Approaches:

    • Transcriptomics reveals gene expression changes upon deletion or overexpression.

    • Proteomics identifies downstream effectors and interaction partners.

  • Synthetic Genetic Array (SGA):

    • High-throughput screens identify genetic interactions that modulate phenotypes associated with SPBC713.13 loss .

  • Comparative Studies:

    • Analyze homologous proteins in related species to infer conserved functions.

Statistical analysis ensures that observed effects are significant and reproducible .

How do genetic interactions inform our understanding of SPBC713.13?

Genetic interaction studies reveal how SPBC713.13 interacts with other genes:

  • Epistasis Analysis: Determines whether SPBC713.13 acts upstream or downstream of interacting genes.

  • Suppressor Screens: Identify mutations that rescue phenotypes caused by loss of SPBC713.13.

  • Synthetic Lethality: Highlights essential pathways where redundancy compensates for its absence.

These approaches provide insights into the broader network within which SPBC713.13 operates .

What are potential applications of studying SPBC713.13?

Understanding SPBC713.13 has implications beyond basic biology:

  • Modeling Human Diseases:

    • Homologs in humans may be linked to disease pathways; studying their yeast counterparts provides mechanistic insights.

  • Drug Discovery:

    • Targeting pathways involving SPBC713.13 could yield novel therapeutics.

  • Biotechnology Applications:

    • Engineering transmembrane proteins for industrial processes benefits from foundational knowledge about their structure-function relationships.

Future research may uncover additional applications as more is learned about this enigmatic protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.