Recombinant Schizosaccharomyces pombe Putative uncharacterized transporter C977.04 (SPAC977.04)

Shipped with Ice Packs
In Stock

Description

Introduction to SPAC977.04

SPAC977.04 encodes a putative membrane transporter in Schizosaccharomyces pombe, commonly known as fission yeast. This protein, identified by the UniProt accession number G2TRN8, is classified as a putative uncharacterized transporter based on sequence analysis and structural predictions . The term "putative" indicates that while this protein likely functions as a transporter based on sequence homology, its specific substrates and precise biological functions remain to be experimentally validated.

Fission yeast serves as an important model organism in molecular and cellular biology research due to its relatively simple genome and cellular organization while maintaining many core eukaryotic processes. Understanding the function of SPAC977.04 could provide valuable insights into membrane transport mechanisms in eukaryotes and potentially reveal novel cellular pathways in which this protein participates.

Expression Systems and Production Methods

The recombinant protein is commonly produced using Escherichia coli as the host organism, though mammalian cell expression systems are also employed by some manufacturers . The gene is typically fused to sequences encoding affinity tags, most commonly histidine (His) tags, to facilitate purification and detection . The expression constructs may contain the full-length protein (amino acids 1-155) or partial sequences depending on the specific application .

Expression SystemAdvantagesCommon Applications
E. coliHigh yield, cost-effectiveStructural studies, antibody production
Mammalian cellsBetter post-translational modificationsFunctional assays, interaction studies

Potential Biological Functions

While the specific function of SPAC977.04 remains to be fully characterized, its classification as a membrane transporter provides a foundation for hypotheses regarding its biological role in fission yeast.

Contextual Analysis in Fission Yeast Biology

Schizosaccharomyces pombe utilizes various membrane transporters to respond to environmental changes and maintain cellular homeostasis. The fission yeast genome encodes numerous transporters involved in processes such as nutrient uptake, ion homeostasis, and stress responses.

Research has established that S. pombe employs sophisticated stress response pathways, notably the Sty1 MAP kinase pathway, which regulates numerous genes in response to environmental stresses such as oxidative stress, heat shock, osmotic stress, and heavy metal exposure . This stress-activated protein kinase pathway is involved in the regulation of numerous stress responses in fission yeast .

While direct evidence linking SPAC977.04 to these stress response pathways is not available from the current literature, it is plausible that as a membrane transporter, it may participate in:

  1. Ion homeostasis during osmotic or oxidative stress

  2. Nutrient acquisition under limiting conditions

  3. Export of toxic compounds or metabolites

  4. Signaling molecule transport

  5. Maintenance of membrane potential

Expression and Regulation

Understanding the expression patterns and regulation of SPAC977.04 could provide insights into its function. In S. pombe, many stress-responsive genes are regulated by the Sty1 MAP kinase pathway and transcription factors such as Atf1p . These regulatory mechanisms coordinate the expression of genes involved in various stress responses, including core environmental stress response (CESR) genes that are activated in response to multiple stresses .

Fission yeast activates specific gene expression programs in response to particular stresses . These "stress-specific" responses are often less dependent on the Sty1p MAP kinase pathway and may involve specialized regulatory factors . Whether SPAC977.04 belongs to the core stress response or a stress-specific program remains to be determined.

Research Applications

The recombinant SPAC977.04 protein has several potential applications in research, particularly in the fields of membrane biology, structural biology, and cellular physiology.

Functional Characterization

Elucidating the function of SPAC977.04 requires systematic approaches to identify its substrates and characterize its transport properties:

ApproachMethodologyExpected Outcome
Transport AssaysReconstitution into liposomes or proteoliposomesSubstrate identification and transport kinetics
ElectrophysiologyPatch-clamp or planar bilayer recordingsChannel or transporter properties
MutagenesisSite-directed mutagenesis of conserved residuesStructure-function relationships
Gene Knockout/KnockdownCRISPR-Cas9 or RNAi techniquesPhenotypic consequences and physiological role

These functional studies would significantly advance our understanding of SPAC977.04's biological role and could potentially reveal novel transport mechanisms.

Protein Interaction Studies

Identifying the interaction partners of SPAC977.04 could provide valuable insights into its cellular function and regulation:

TechniqueApplicationPotential Discoveries
Co-immunoprecipitationIsolation of protein complexesDirect binding partners
Yeast Two-HybridScreening for interacting proteinsRegulatory interactions
Proximity LabelingIdentification of nearby proteinsMembrane microenvironment
Cross-linking Mass SpectrometryCapture of transient interactionsDynamic protein complexes

The recombinant protein, particularly with affinity tags such as the His tag, serves as a valuable tool for these interaction studies.

References Product Overview: Recombinant Full Length Schizosaccharomyces pombe Putative uncharacterized transporter C977.04 (SPAC977.04) Protein (G2TRN8) (1-155aa), fused to N-terminal His tag, was expressed in E. coli. ELISA Recombinant Schizosaccharomyces pombe Putative uncharacterized transporter C977.04 (SPAC977.04). Recombinant Schizosaccharomyces pombe Putative uncharacterized transporter C977.04 (SPAC977.04), partial. The stress-induced expression of many fission yeast genes is dependent upon the Sty1 MAP kinase (MAPK) and Atf1 transcription factor. In the fission yeast Schizosaccharomyces pombe, the Sty1/Spc1/Phh1p protein kinase pathway is involved in the regulation of numerous stress responses.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol utilizes 50% glycerol; this may be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To prioritize a specific tag, please specify it during your order placement.
Synonyms
SPAC977.04; Putative uncharacterized transporter C977.04
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC977.04
Target Protein Sequence
MPINQKFYSYLVKRNGGEGEPEFRLPMGFIGITLFEIGILLFGWTARYKIFWFVPTIGSA IMGGGYIMTSNPLNMYVVDSYGIYSASASAGVKIFQLLLGAIFPLFAESLFRRLNYGWGC TLLAFILLACGCSLPILFKYGKQIRNLRPFDPSKY
Uniprot No.

Target Background

Database Links
Protein Families
Major facilitator superfamily, CAR1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should SPAC977.04 recombinant protein be stored for optimal stability?

For optimal stability, recombinant SPAC977.04 protein should be stored at -20°C or -80°C upon receipt. For working solutions, the protein is typically provided in a Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

When handling the protein:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Prepare working aliquots and store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can degrade the protein

What expression systems are most effective for producing recombinant SPAC977.04 protein?

E. coli has been demonstrated as an effective heterologous expression system for SPAC977.04, particularly when fused to an N-terminal His tag . When designing expression experiments:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay require optimization of codon usage for a yeast protein
S. pombeNative post-translational modificationsLower yield compared to bacterial systems
S. cerevisiaeEukaryotic processing, secretion capabilityMay require specific vector adjustments
Insect cellsComplex folding capability for membrane proteinsTime-consuming, higher cost

For membrane proteins like SPAC977.04, consider using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)) or supplementing with chaperones to improve folding . The protein has been successfully expressed as a full-length construct (1-155 aa) with N-terminal His-tag, suggesting this approach may be optimal for maintaining functionality .

How should gene expression experiments be designed to study SPAC977.04 regulation in S. pombe?

For studying gene expression of SPAC977.04 in S. pombe, consider the following experimental design approach:

  • Experimental conditions:

    • Culture S. pombe cells (e.g., strain 972 / ATCC 24843) in YEA medium at 30°C with shaking at 200 rpm

    • Harvest cells at mid-log phase (OD600 of approximately 0.2, which is equivalent to ~4 × 10^6 cells/ml)

  • Statistical design:

    • Perform at least three independent biological repeats

    • Create appropriate design matrices to account for variables in your experiment

    • For time-course experiments, collect samples at multiple timepoints (e.g., 0, 20, 50, 80, and 120 minutes)

  • Controls:

    • Include wild-type and relevant mutant strains (e.g., checkpoint mutants, stress-activated protein kinase mutants)

    • Compare synchronized vs. asynchronous cell populations

  • RNA extraction and analysis:

    • Extract total RNA using hot phenol methods

    • Utilize microarray or RNA-seq approaches for comprehensive expression analysis

    • Label samples from each experimental condition and hybridize with a labeled control sample

This approach has been validated in similar studies examining gene expression responses in S. pombe under various conditions, including response to ionizing radiation .

What methodologies are most effective for determining the substrate specificity of SPAC977.04?

Since SPAC977.04 is a putative uncharacterized transporter, determining its substrate specificity requires a systematic approach:

  • Bioinformatic prediction:

    • Analyze sequence homology with characterized transporters

    • Identify conserved domains associated with specific substrate transport

    • Use transmembrane topology prediction tools to map potential substrate binding sites

  • Heterologous expression systems:

    • Express SPAC977.04 in transport-deficient yeast strains

    • Test growth complementation with various potential substrates

    • Monitor substrate uptake using radiolabeled or fluorescently tagged compounds

  • In vitro transport assays:

    • Reconstitute purified protein into liposomes

    • Measure substrate transport using:

      • Fluorescent substrate analogs

      • Radiolabeled substrate uptake

      • Transport-coupled ion flux measurements

  • Mutagenesis studies:

    • Generate point mutations in predicted substrate binding regions

    • Assess changes in transport kinetics (Km, Vmax) for various substrates

    • Create chimeric proteins with domains from characterized transporters

Given the membrane localization and sequence characteristics, initial screening should focus on small molecules, ions, or metabolites relevant to S. pombe cellular compartmentalization.

How can researchers integrate SPAC977.04 studies with global metabolic profiling in S. pombe?

Integrating SPAC977.04 studies with global metabolic profiling requires a multi-omics approach:

  • Generate SPAC977.04 deletion and overexpression strains:

    • Use CRISPR/Cas9 or homologous recombination techniques specific for S. pombe

    • Confirm genotype by PCR and expression changes by qRT-PCR

  • Perform comparative metabolomics:

    • Extract metabolites from wild-type and mutant strains under various conditions

    • Analyze using LC-MS/MS and GC-MS platforms

    • Identify metabolites that show significant changes in concentration

  • Correlate with transcriptomics data:

    • Perform RNA-seq analysis on the same samples

    • Identify co-regulated genes and pathways

    • Apply statistical methods similar to those used in gene expression studies with appropriate design matrices

  • Validate functional connections:

    • Use isotope labeling to track metabolite flux

    • Perform targeted metabolite supplementation experiments

    • Assess phenotypic changes in response to metabolic perturbations

  • Integration with existing data:

    • Apply a strategy similar to that used for Phx1-dependent gene analysis in S. pombe

    • Identify metabolic pathways potentially affected by SPAC977.04 activity

This integrated approach can reveal the metabolic context in which SPAC977.04 functions and provide insights into its physiological role in S. pombe metabolism.

What are the optimal conditions for purifying functional SPAC977.04 for structural studies?

Purifying membrane proteins like SPAC977.04 for structural studies presents unique challenges that require specialized approaches:

  • Solubilization optimization:

    Detergent TypeConcentration RangeBest For
    DDM0.5-1%Initial extraction
    LMNG0.01-0.05%Increased stability
    SMA copolymers2.5%Native lipid environment preservation
  • Purification strategy:

    • Utilize the His-tag for initial IMAC purification

    • Follow with size exclusion chromatography

    • Consider additional ion exchange chromatography for higher purity

    • Maintain detergent above critical micelle concentration throughout

  • Stability screening:

    • Test thermal stability using differential scanning fluorimetry

    • Optimize buffer conditions (pH 6.5-8.0, salt concentration 150-300mM)

    • Screen additives (glycerol, specific lipids, substrate candidates)

  • Quality assessment:

    • Verify monodispersity by dynamic light scattering

    • Assess functionality through binding or transport assays

    • Check protein folding using circular dichroism

  • Crystallization considerations:

    • Use vapor diffusion or lipidic cubic phase methods

    • Screen with commercial membrane protein-specific crystallization kits

    • Consider protein engineering (thermostabilizing mutations, fusion partners)

These approaches have been successful for similar membrane transporters and could be adapted for SPAC977.04 structural studies.

How can researchers develop assays to measure transport activity of purified SPAC977.04?

Developing functional assays for an uncharacterized transporter requires screening multiple potential substrates and transport mechanisms:

  • Liposome reconstitution:

    • Reconstitute purified protein into liposomes with defined lipid composition

    • Create inside-out and right-side-out vesicle populations

    • Establish ion gradients across the membrane when appropriate

  • Transport measurement approaches:

    • Fluorescence-based assays:

      • pH-sensitive dyes for proton-coupled transport

      • Substrate-specific fluorescent probes

      • FRET-based reporter systems

    • Electrical measurements:

      • Solid-supported membrane electrophysiology

      • Patch-clamp of proteoliposomes or reconstituted systems

    • Direct substrate quantification:

      • Radiolabeled substrate uptake

      • LC-MS detection of transported molecules

  • Kinetic analysis:

    • Determine transport rates at varying substrate concentrations

    • Calculate Km and Vmax parameters

    • Assess inhibition profiles with potential transport blockers

  • Control experiments:

    • Use protein-free liposomes as negative controls

    • Employ known transporters as positive controls

    • Test inactive mutants (e.g., conserved residue substitutions)

This systematic approach can help identify the transport function of SPAC977.04 even without prior knowledge of its substrate specificity.

What computational approaches can predict the functional role of SPAC977.04 in S. pombe cellular processes?

Multiple computational approaches can provide insights into SPAC977.04 function:

  • Evolutionary analysis:

    • Perform phylogenetic analysis against characterized transporters

    • Identify orthologs in other species with known functions

    • Analyze patterns of conservation and co-evolution with other proteins

  • Network integration:

    • Construct protein-protein interaction networks

    • Analyze co-expression patterns across various conditions

    • Apply gene ontology enrichment to identify associated biological processes

  • Structural prediction:

    • Generate 3D structural models using AlphaFold or similar tools

    • Identify potential substrate binding pockets

    • Compare with structures of functionally characterized transporters

  • Genomic context analysis:

    • Examine neighboring genes for functional clues

    • Look for conserved gene clusters across species

    • Identify potential operon-like arrangements

  • Machine learning approaches:

    • Train models on known transporters to predict substrate classes

    • Use feature extraction from sequence and predicted structure

    • Validate predictions with experimental data

These computational methods can generate testable hypotheses about SPAC977.04 function that guide experimental design and interpretation.

How can researchers integrate SPAC977.04 analysis into broader S. pombe transcriptomic studies?

Integrating SPAC977.04 into broader transcriptomic studies requires several methodological considerations:

  • Experimental design matrix development:

    • Establish appropriate factors and covariates for experimental conditions

    • Design matrices should account for all relevant experimental variables

    • Ensure proper statistical power through adequate biological replicates

  • Condition selection:

    • Include stress conditions that might reveal SPAC977.04 function

    • Consider cell cycle synchronization to detect phase-specific expression

    • Test nutritional limitations that might trigger transporter expression

  • Data analysis pipeline:

    • Normalize expression data appropriately for the platform used

    • Apply statistical models that account for experimental design

    • Use visualization techniques to identify patterns and outliers

  • Network analysis:

    • Construct co-expression networks to identify genes with similar expression patterns

    • Apply clustering algorithms to find functional modules

    • Use differential co-expression analysis to identify condition-specific relationships

  • Integration with other omics data:

    • Combine transcriptomics with proteomics and metabolomics

    • Apply multi-omics integration tools

    • Develop customized analytical approaches for membrane transporters

Specific example from literature: In S. pombe transcriptomic studies examining responses to ionizing radiation, researchers used three independent biological repeats and hybridized labeled samples from each irradiated time point with a labeled unirradiated sample . A similar approach could be adapted for studies involving SPAC977.04.

How can CRISPR/Cas9 technology be optimized for functional studies of SPAC977.04 in S. pombe?

Optimizing CRISPR/Cas9 for SPAC977.04 studies in S. pombe requires specific considerations:

  • Guide RNA design:

    • Select target sites with minimal off-target potential

    • Consider S. pombe-specific codon usage and GC content

    • Design multiple gRNAs targeting different regions of the gene

  • Delivery system optimization:

    • Use vectors with appropriate promoters for S. pombe (e.g., rrk1, adh1)

    • Consider integrating Cas9 into the genome for stable expression

    • Optimize transformation protocols for high efficiency

  • Editing strategy:

    • For knockout: Design repair templates with selectable markers

    • For point mutations: Provide specific repair templates with desired mutations

    • For tagging: Create in-frame fusions with fluorescent proteins or affinity tags

  • Validation approaches:

    • PCR and sequencing to confirm genomic modifications

    • RT-qPCR to verify expression changes

    • Western blotting to confirm protein modification/absence

    • Phenotypic assays to assess functional consequences

  • Multiplex editing:

    • Target SPAC977.04 alongside related transporters

    • Create combinatorial mutants to address redundancy

    • Integrate with regulators to study pathway connections

These approaches allow for precise genetic manipulation of SPAC977.04 to study its function, localization, and interactions in the native cellular context.

What approaches can resolve contradictory findings about SPAC977.04 function across different experimental systems?

Resolving contradictory findings requires systematic investigation of potential variables:

  • System-specific differences analysis:

    • Compare expression levels across systems

    • Assess post-translational modifications

    • Evaluate membrane composition differences

    • Examine potential interacting partners

  • Standardization approach:

    • Develop consistent protocols across research groups

    • Create reference strains and reagents

    • Establish benchmark assays with positive and negative controls

  • Combinatorial validation:

    • Apply multiple independent techniques to the same question

    • Use both in vivo and in vitro approaches

    • Combine genetic, biochemical, and physiological methods

  • Contextual considerations:

    • Examine growth conditions and media composition

    • Consider cell density and growth phase effects

    • Evaluate genetic background influences

  • Meta-analysis framework:

    • Systematically compare methodologies across studies

    • Identify potential confounding variables

    • Develop integrative models that account for contradictions

This systematic approach helps identify whether contradictions stem from technical issues, biological context differences, or reflect genuine complexity in SPAC977.04 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.