Recombinant Schizosaccharomyces pombe Reticulon-like protein 1 (rtn1)

Shipped with Ice Packs
In Stock

Description

Molecular Identification and Basic Characteristics

Recombinant rtn1 is encoded by the rtn1 gene (also termed cwl1) and produced via E. coli expression systems. Key identifiers include:

PropertyDetail
UniProt IDP53694
Gene Namesrtn1, cwl1 (SPBC31A8.01c, SPBC651.13c)
Protein Length308 amino acids (full-length)
Expression Region1–308
Post-Translational FeaturesPredicted Reticulon Homology Domain (RHD) for membrane curvature shaping

Domain Architecture

  • RHD Domain: Critical for ER tubule formation and nuclear envelope organization .

  • Coiled-Coil Regions: Facilitate dimerization and interactions with ER-shaping proteins like Tts1p and Yop1p .

Cellular Roles

  • ER Membrane Dynamics: Collaborates with Tts1p (TMEM33 homolog) and Yop1p to maintain cortical ER networks, ensuring proper actomyosin ring positioning during cell division .

  • DNA Repair Context: Indirect associations with replication fork barriers (RTS1) and recombination mediators (e.g., Rrp1/2) suggest potential cross-talk between ER structure and genome stability .

Experimental Use Cases

  • Yeast Two-Hybrid Assays: Used to identify interactions with ER-resident proteins (e.g., Tts1p) .

  • Structural Studies: SAXS (small-angle X-ray scattering) and hydrodynamic analyses to model elongated conformations .

Key Research Findings

  • ER-Positioning in Cell Division: Depletion of rtn1 disrupts cortical ER networks, leading to mislocalized actomyosin rings and cytokinesis defects .

  • Conservation with Mammalian Systems: Functional parallels exist with human reticulons (e.g., RTN4/NOGO) in ER tubule formation and membrane curvature regulation .

Sequence and Biochemical Data

Biochemical Properties:

  • Storage Buffer: Tris-based with 50% glycerol .

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .

Future Directions

  • Mechanistic Studies: Elucidate rtn1’s role in ER-replication fork crosstalk during DNA damage .

  • Therapeutic Exploration: Leverage structural insights to design ER-targeted therapies for neurodegenerative diseases linked to reticulon dysregulation .

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that specific tag.
Synonyms
rtn1; cwl1; SPBC31A8.01c; SPBC651.13c; Reticulon-like protein 1; Cell lysis protein cwl1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
Target Protein Sequence
MSEQHSLNPFESGSVTASDVAAAKSGAEDLVNTLTAHTVHPSTELPSATSFPSALPNSEN PVIQNISSSSSEPHHTSQSTPGETSSPVCPVSGAHGGADKKCPALEAGCPFTNTTKQNVD PEISNALWSVLTWKNTSCSFSTLMSILALVYVPSWINLPRLFFRTFRYVFLITSIIEFGG LFASNGKRGVLSHFRSSYITCDSKALDRIVNSIVDIFNVMLIQFQRILFAESPILTFTAS VAAFIEFFLSGFLSYKSLFVWNVLFAFILPRLYVCNERSIKHLVASLERSGDKLKKQATE TINTTVNK
Uniprot No.

Target Background

Function
Essential for the correct positioning of the cellular division plane. It achieves this by defining the actomyosin ring assembly at the cell equator. Overexpression leads to cell lysis.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein. Note=Enriched at the cell equator during mitosis.

Q&A

What is Schizosaccharomyces pombe Reticulon-like protein 1 (rtn1) and what is its genomic location?

Reticulon-like protein 1 (rtn1) is an endoplasmic reticulum (ER) membrane-shaping protein found in the fission yeast Schizosaccharomyces pombe. It is also known as cell wall lysis protein (cwl1) and is encoded by the gene located at chromosomal positions SPBC31A8.01c and SPBC651.13c . The rtn1 protein consists of 308 amino acids and contains reticulon homology domains (RHDs) with characteristic hydrophobic regions that are important for its membrane-shaping functions . As defined in the Protein Ontology database, it is "a protein that is a translation product of the rtn1 gene in Schizosaccharomyces pombe 972h-" .

What is the primary function of rtn1 in S. pombe?

Rtn1 plays a crucial role in maintaining the structure of the endoplasmic reticulum (ER) in S. pombe. Its primary functions include:

  • Stabilizing the tubular form of the ER at the expense of the sheet form

  • Contributing to nuclear envelope dynamics during cell division

  • Maintaining cell wall integrity

Research has demonstrated that rtn1 functions by inducing and stabilizing membrane curvature in the ER tubules. When rtn1 is deleted, the conformation of tubular ER at the cell periphery changes, causing it to detach from the cell periphery, which is consistent with a conversion of tubular ER to sheet ER .

How does deletion of rtn1 affect S. pombe phenotype?

Phenotypic FeatureEffect of rtn1Δ
Cell viabilityNot affected
ER morphologyChanges from tubular to sheet form at cell periphery
ER attachment to cell peripheryDetachment observed
Nuclear envelope dynamicsAltered during division
Septum positioningNoticeable defect, though weaker than some other ER-shaping proteins
ER-phagy (ER autophagy)Only slightly diminished when combined with yop1Δ and tts1Δ

When rtn1Δ is combined with mutations in other ER-shaping proteins (such as yop1Δ and tts1Δ), more severe phenotypes are observed, particularly in septum positioning, indicating functional redundancy among these proteins .

How is rtn1 related to other reticulon proteins across species?

Reticulons form an evolutionarily conserved family of membrane proteins. Phylogenetic analysis shows that while land vertebrates typically have four reticulon paralogs (RTN1, RTN2, RTN3, and RTN4), S. pombe has only one reticulon gene (rtn1) .

This evolutionary conservation suggests that reticulon proteins serve fundamental cellular functions across eukaryotes. In humans, for example, RTN1 has been implicated in kidney disease progression through induction of ER stress . The mammalian reticulon that shows highest similarity to S. pombe rtn1 is mammalian CRE-BP1, based on sequence homology .

Understanding the relationship between S. pombe rtn1 and human reticulons provides valuable insights into the potential use of fission yeast as a model for studying reticulon-related human diseases.

What methods can be used to generate and purify recombinant S. pombe rtn1 for functional studies?

For researchers seeking to perform functional studies with recombinant S. pombe rtn1, several methodological approaches can be employed:

Expression Systems:

  • E. coli expression: Glutathione S-transferase (GST)-Rtn1 fusion proteins have been successfully produced in E. coli . This approach is useful for in vitro binding studies.

  • S. pombe expression: For maintaining native post-translational modifications, expression in S. pombe using stable integration vectors (SIVs) is recommended .

Purification Protocol:

  • Express the protein with an appropriate tag (His, GST, etc.)

  • Optimize lysis conditions (consider that rtn1 is a membrane protein)

  • Purify using affinity chromatography

  • For membrane proteins like rtn1, use detergents such as Triton X-100 or DDM during purification

  • Consider using Tris-based buffer with 50% glycerol for storage at -20°C

Storage Recommendations:

  • Store at -20°C for short-term storage

  • For extended storage, conserve at -80°C

  • Avoid repeated freezing and thawing

  • Working aliquots can be stored at 4°C for up to one week

What experimental approaches can be used to study rtn1's role in ER membrane dynamics?

Several sophisticated experimental approaches can be employed to investigate rtn1's role in ER membrane dynamics:

In vivo imaging techniques:

  • Fluorescent tagging: GFP-tagging of rtn1 allows visualization of its localization and dynamics in live cells . The stable integration vectors (SIVs) described by Vještica et al. provide excellent tools for this purpose .

  • Correlative light and electron microscopy (CLEM): This technique can reveal the ultrastructural details of ER morphology changes in rtn1Δ strains.

Biochemical and genetic approaches:

  • Genetic interactions: Combining rtn1Δ with mutations in other genes involved in ER organization (e.g., yop1Δ, tts1Δ) can reveal functional relationships .

  • Membrane tubulation assays: In vitro assays using purified recombinant rtn1 and artificial liposomes can demonstrate its direct role in membrane curvature induction.

  • ER stress assessment: Monitoring ER stress markers in wild-type vs. rtn1Δ strains under various conditions can reveal the functional consequences of altered ER morphology.

Quantitative phenotypic analyses:

  • Nuclear division dynamics: Time-lapse microscopy of nuclear division in rtn1Δ strains, particularly in sensitized backgrounds like pim1-d1, can reveal the role of rtn1 in nuclear envelope dynamics during mitosis .

  • Septum positioning analysis: Quantitative scoring of septum defects provides a sensitive readout for subtle ER organization defects in rtn1Δ single and compound mutants .

How does rtn1 contribute to nuclear envelope dynamics during cell division in S. pombe?

Rtn1 plays a significant role in nuclear envelope (NE) dynamics during the closed mitosis of S. pombe, where the NE remains intact throughout division. Research by Lim et al. revealed:

  • During normal mitosis, nuclear area rapidly increases by approximately 26% while nuclear volume remains constant, requiring addition of membrane from the ER reservoir .

  • Rtn1 influences this process by regulating the conversion between tubular and sheet forms of the ER, which affects membrane availability for NE expansion .

  • In cells lacking rtn1 (rtn1Δ), the conformation of the ER changes from tubular to sheet form, facilitating lipid incorporation into the NE during division .

  • This change in ER conformation has significant functional consequences in certain genetic backgrounds. For example, in pim1-d1 mutants (defective in the Ran-GTPase pathway), which exhibit NE breakage upon spindle elongation, deletion of rtn1 partially rescues this phenotype .

  • The protective effect of rtn1Δ is thought to result from enhanced lipid redistribution from the ER to the NE, which provides additional membrane material to accommodate spindle elongation without NE rupture .

This research highlights how rtn1-mediated regulation of ER-NE membrane dynamics is crucial for maintaining nuclear integrity during cell division in the closed mitosis of fission yeast.

What are the coordinated functions of rtn1 with other ER-shaping proteins in S. pombe?

S. pombe contains multiple ER-shaping proteins that work in concert to maintain proper ER morphology. The relationships between these proteins reveal a complex network of functional interactions:

Protein CombinationPhenotypic EffectFunctional Implication
rtn1ΔMild septum positioning defectRtn1 contributes to but is not essential for ER structure
rtn1Δ yop1ΔEnhanced septum defect compared to single mutantsPartial functional redundancy between Rtn1 and Yop1
rtn1Δ tts1ΔEnhanced septum defect compared to single mutantsPartial functional redundancy between Rtn1 and Tts1
rtn1Δ tts1Δ yep1ΔSevere septum positioning defectPronounced synthetic interaction revealing cooperative functions
rtn1Δ yop1Δ tts1ΔSevere ER structure defectsTriple deletion severely compromises ER tubulation
rtn1Δ yop1Δ tts1Δ + Yep1 overexpressionAmeliorated septum positioning defectYep1 can partially compensate for loss of other ER-shaping proteins

These genetic interaction studies reveal that:

  • Rtn1, Yop1, and Tts1 have partially overlapping functions in maintaining ER structure in S. pombe.

  • The combined loss of these proteins results in synthetic phenotypes more severe than individual deletions.

  • Yep1 shares the membrane-shaping ability of Rtn1, Yop1, and Tts1 and contributes to normal ER structure.

  • ER-phagy (autophagy of ER) is only slightly diminished in the rtn1Δ yop1Δ tts1Δ triple deletion mutant, suggesting these proteins are not essential for this process .

  • Overexpression of Rtn1, Yop1, or Tts1 cannot alleviate the severe ER-phagy defect of yep1Δ, indicating that Yep1 has a unique essential role in ER-phagy that cannot be substituted by these other proteins .

How can S. pombe rtn1 research inform our understanding of reticulon-related human diseases?

Research on S. pombe rtn1 provides valuable insights into human reticulon biology and associated diseases:

Kidney Disease Models:
Human RTN1, particularly the RTN1A isoform, has been implicated in kidney disease progression through induction of ER stress . Studies have shown that:

  • Increased RTN1A expression correlates with severity of chronic kidney disease (CKD) in human patients .

  • RTN1A interacts with PERK (an ER stress sensor) through its N-terminal and C-terminal domains, inducing ER stress and apoptosis in renal cells .

  • Knockdown of RTN1A expression in vivo attenuates ER stress, renal fibrosis, and diabetic kidney injury in mouse models .

Research Translation Approaches:
Researchers can leverage S. pombe rtn1 studies to understand human reticulon function by:

  • Comparative structural analysis: The conserved C-terminal reticulon homology domain in both S. pombe rtn1 and human RTN1 suggests shared functional mechanisms .

  • Heterologous expression studies: Human RTN1 can be expressed in rtn1Δ S. pombe to assess functional conservation and disease-associated variants.

  • Structure-function analysis: Using S. pombe as a model system for structure-function studies of reticulon domains can inform therapeutic targeting of human RTN1.

  • Genetic modifier screens: Identifying suppressors of rtn1-related phenotypes in S. pombe may reveal potential therapeutic targets for RTN1-associated human diseases.

Molecular mechanisms:
Research has shown that both S. pombe rtn1 and human RTN1 function in ER membrane organization, suggesting conservation of fundamental mechanisms:

  • Both proteins shape ER tubules through their reticulon homology domains .

  • Both influence cellular stress responses, with human RTN1A specifically implicated in ER stress induction .

  • Understanding how rtn1 regulates ER-nuclear envelope dynamics in fission yeast may provide insights into how human reticulons influence nuclear morphology in human cells.

By using the genetically tractable S. pombe system to understand fundamental aspects of reticulon biology, researchers can generate hypotheses about human reticulon functions that can then be tested in more complex mammalian models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.