Recombinant Schizosaccharomyces pombe Rhomboid protein 2 (rbd2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rbd2; SPCC790.03; Rhomboid protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
rbd2
Target Protein Sequence
MILGRSKEFILKLPIWTQIITYIAILVYALSFFGISTGVLSLSWIGLLQKRQLYEIITYV TLHLSMLHIVFNFVSLLPAMSQFEKKQGTLACILVTVIPYTLFPGIMHLIVYHFFLRKDY VSIAGLSGWAFAFISASCVHSPQRLISFFNLFSIPAYCFPIIYLIMTTILVPKASFIGHA SGAVMGYCTPFMLGSIPLKSWAQNVDPIFQSWVKNYHSFDQLSHAQLPIAEPLSTFSSFP GKGTRLGG
Uniprot No.

Target Background

Function
This protein is likely a serine protease.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Rhomboid Protein 2 (rbd2) and what is its primary function?

Schizosaccharomyces pombe Rhomboid protein 2 (rbd2) is a Golgi-resident rhomboid protease that plays a crucial role in sterol regulatory element-binding protein (SREBP) cleavage activation. Bioinformatic analysis reveals that S. pombe Rbd2 shares significant homology with GlpG, a well-studied bacterial member of the rhomboid family of intramembrane proteases . As a membrane-embedded serine protease, Rbd2 is essential for the proteolytic processing of SREBP transcription factors (Sre1 and Sre2), which regulate lipid homeostasis in fission yeast .

The catalytic function of Rbd2 has been confirmed through genetic analysis, where mutations in keystones III and IV (key architectural motifs conserved in all rhomboid proteases) result in phenotypes resembling complete deletion of rbd2 . The protein works within a Dsc E3 ligase complex-dependent pathway, where Dsc E3-mediated ubiquitinylation appears to be a prerequisite for Rbd2 function .

What structural characteristics define S. pombe Rbd2 and how do they relate to its function?

S. pombe Rbd2 possesses specific structural features characteristic of rhomboid proteases that directly relate to its proteolytic function:

Key structural features:

  • Six predicted transmembrane domains (TM) with N- and C-termini in the cytoplasm

  • Catalytic Ser-His dyad positioned in the fourth (S130) and sixth (H182) TM segments

  • Conserved "GxSG" motif surrounding the catalytic Ser in TM4

  • "GxxxG" helix dimerization motif in TM6

  • "HxxxxHxxxN" motif in TM2, characteristic of rhomboid proteases

  • SHP box in the cytosolic C-terminus that serves as a Cdc48 interaction domain

The significance of these structural elements has been confirmed through mutational analysis. Three specific mutations - rbd2-A127D, rbd2-G128A, and rbd2-A186T - have been identified in keystones III and IV, which are key architectural motifs conserved in all rhomboid proteases. These mutations result in phenotypes resembling complete deletion of rbd2, confirming their importance for enzyme function .

Notably, the SHP box in the C-terminus of S. pombe Rbd2 is not present in Saccharomyces cerevisiae Rbd2, suggesting distinct functions between these orthologous proteins .

How does Rbd2 interact with the Cdc48 protein and what is the significance of this interaction?

The interaction between Rbd2 and Cdc48 represents a critical functional aspect of SREBP processing in S. pombe:

The C-terminal, cytosolic tail of Rbd2 contains a SHP box that binds directly to Cdc48, and disruption of this Rbd2–Cdc48 binding blocks SREBP cleavage . Genetic experiments indicate that Cdc48 recruits SREBP to Rbd2 for cleavage, identifying a function for Cdc48 that is independent from its known role in binding to the Dsc E3 ligase .

This mechanism differs from that observed in mammalian systems, where the mammalian rhomboid RHDBL4 also binds p97 (the mammalian homolog of Cdc48), but in that case, p97 functions after cleavage to promote degradation of cleaved products .

The Rbd2-Cdc48 interaction thus represents a key regulatory step in the SREBP pathway, where Cdc48 appears to function as a substrate-delivery factor, bringing the SREBP substrate to the Rbd2 protease for cleavage.

What experimental approaches are used to study Rbd2's role in SREBP cleavage?

Researchers have employed multiple complementary techniques to investigate Rbd2's role in SREBP cleavage:

Genetic approaches:

  • Genetic interaction mapping using high-throughput screens to identify functionally related genes

  • Epistasis analysis to position Rbd2 within the SREBP pathway relative to the Dsc E3 ligase

  • Generation of specific point mutations to identify critical residues for Rbd2 function

Localization studies:

  • Fusion of Rbd2 to fluorescent proteins (e.g., Rbd2-6xmCherry) to visualize subcellular localization

  • Co-localization experiments with known Golgi markers (Sec72-6xGFP and Dsc2-6xGFP)

Biochemical methods:

  • Yeast two-hybrid assays to detect protein-protein interactions

  • Western blot analysis to monitor SREBP cleavage in wild-type versus rbd2 mutant cells

  • Protein turnover assays using cycloheximide to assess protein stability

Advanced technologies:

  • Proximity biotin labelling-based mass spectrometry (TurboID) to identify associated proteins

These methods have collectively established Rbd2's function as a Golgi-resident rhomboid protease essential for SREBP cleavage in S. pombe.

How can recombinant S. pombe Rbd2 be efficiently expressed and purified for biochemical studies?

While the search results don't provide specific protocols for Rbd2, we can outline a methodological approach based on successful recombinant protein expression in S. pombe and other yeast systems:

Expression system options:

  • E. coli expression system:

    • Clone the rbd2+ gene into a bacterial expression vector (e.g., pET28a) with an affinity tag (His-tag)

    • Express in E. coli BL21(DE3) using IPTG induction (typically 0.5-1mM IPTG at 16-25°C for membrane proteins)

    • Solubilize membranes using appropriate detergents (e.g., DDM, LMNG)

    • Purify using Ni-NTA affinity chromatography followed by size exclusion chromatography

  • S. pombe expression system:

    • Clone rbd2+ into an S. pombe expression vector (e.g., pREP series) with an affinity tag

    • Transform into appropriate S. pombe strain (protease-deficient strains recommended)

    • Induce expression by thiamine withdrawal (for nmt1 promoter)

    • Harvest cells and prepare membrane fractions

    • Solubilize and purify as with E. coli system

Critical considerations:

  • Membrane proteins like Rbd2 often require specific detergents for extraction while maintaining activity

  • Consider adding stabilizing lipids during purification

  • Activity assays should be performed with synthetic peptide substrates derived from known Rbd2 substrates (Sre1/Sre2)

Testing functionality:
After purification, the recombinant protein can be validated using:

  • Western blotting with anti-tag antibodies

  • Proteolytic activity assays using fluorogenic peptide substrates

  • Structural analysis by circular dichroism or limited proteolysis

What methods can be used to detect the activity of recombinant Rbd2 in vitro?

Assessing the proteolytic activity of recombinant Rbd2 is crucial for functional studies and requires specialized techniques for membrane proteases:

In vitro proteolytic assays:

  • Synthetic fluorogenic peptide substrates:

    • Design peptides spanning the known cleavage sites in Sre1/Sre2

    • Incorporate fluorophore/quencher pairs that increase fluorescence upon cleavage

    • Monitor reaction kinetics in detergent micelles or reconstituted proteoliposomes

  • Reconstitution in artificial membranes:

    • Incorporate purified Rbd2 into liposomes or nanodiscs

    • Add purified substrate proteins (recombinant fragments of Sre1/Sre2)

    • Detect cleavage products by SDS-PAGE or western blotting

  • Mass spectrometry analysis:

    • Incubate recombinant Rbd2 with substrate proteins

    • Analyze reaction products by LC-MS/MS to identify exact cleavage sites

    • Compare cleavage patterns between wild-type and mutant Rbd2 variants

Controls and validation:

  • Include catalytically inactive mutants (S130A) as negative controls

  • Test substrate specificity using peptides with modified cleavage sites

  • Examine the effects of known rhomboid inhibitors (e.g., DCI, isocoumarin derivatives)

A rigorous activity assay should demonstrate both the proteolytic function of Rbd2 and its substrate specificity, which distinguishes true enzymatic activity from non-specific degradation.

How do mutations in rbd2 affect its function and what do they reveal about its mechanism?

Mutational analysis has provided significant insights into the structure-function relationships of Rbd2:

Key rbd2 mutations and their effects:

MutationLocationPhenotypic EffectMechanistic Insight
rbd2-A127DKeystone IIIDefective Sre1/Sre2 cleavage similar to rbd2ΔCritical for maintaining proper protein fold
rbd2-G128AKeystone IIIDefective Sre1/Sre2 cleavage similar to rbd2ΔLikely impacts the geometry of the catalytic site
rbd2-A186TKeystone IVDefective Sre1/Sre2 cleavage similar to rbd2ΔAffects a conserved architectural motif
S130ACatalytic serineLoss of proteolytic activityConfirms the catalytic mechanism
H182ACatalytic histidineLoss of proteolytic activityValidates the Ser-His catalytic dyad

These mutations have been instrumental in confirming that:

  • Rbd2 functions as a bona fide rhomboid protease requiring an intact catalytic dyad

  • The conserved architectural keystones are essential for proper enzyme function

  • The catalytic mechanism likely follows the general serine protease mechanism with the Ser-His dyad

Researchers identified these mutations through a genetic selection approach to identify genes defective for Sre1 cleavage. The mutants were tested for linkage to rbd2Δ, and DNA sequencing revealed the specific mutations .

What are the genetic interactions of rbd2 and how do they inform our understanding of its cellular functions?

Genetic interaction studies have positioned Rbd2 within the broader cellular context and SREBP pathway:

Genetic interaction mapping:
Hierarchical clustering of genetic interaction profile correlations revealed that rbd2 (SPCC790.03) was correlated with dsc1-dsc4 and sre2, suggesting a functional relationship with these genes in the SREBP pathway . This clustering approach identified functionally related genes, providing unbiased evidence for rbd2's involvement in the Dsc-dependent SREBP pathway.

Epistasis analysis:
Epistasis analysis showed that the Dsc E3 ligase complex functions prior to Rbd2, suggesting that Dsc E3-mediated ubiquitinylation is a prerequisite for Rbd2 function . This positions Rbd2 downstream of the Dsc complex in the SREBP processing pathway.

Key genetic relationships:

  • rbd2 mutations phenocopy dsc mutations in terms of defective SREBP cleavage

  • rbd2 functions downstream of Dsc E3 ligase-mediated ubiquitination

  • The SHP box in Rbd2 is functionally important for Cdc48 interaction

  • Multiple genes in the SREBP pathway cluster together in genetic interaction profiles

These genetic relationships have helped construct a model where the Dsc E3 ligase complex first ubiquitinates SREBP, followed by Cdc48-mediated recruitment of SREBP to Rbd2 for proteolytic cleavage.

How does S. pombe Rbd2 differ from its homologs in other organisms?

Comparative analysis of Rbd2 across species reveals important evolutionary adaptations:

S. pombe vs. S. cerevisiae Rbd2:

  • S. pombe Rbd2 contains a SHP box (Cdc48 interaction domain) in its cytosolic C-terminus that is absent in S. cerevisiae Rbd2

  • This suggests distinct functions between these orthologous proteins, with S. pombe Rbd2 specifically evolved for SREBP processing

  • S. cerevisiae lacks the SREBP pathway entirely, suggesting that its Rbd2 has different cellular functions

S. pombe Rbd2 vs. mammalian rhomboid proteases:

  • The mammalian rhomboid RHDBL4 also binds p97 (mammalian Cdc48), but in mammals, p97 functions after cleavage to promote degradation of cleaved products

  • In S. pombe, Cdc48 appears to function before cleavage, recruiting SREBP to Rbd2

  • This represents a fundamental mechanistic difference in how similar proteases function across evolution

Conservation of key domains:
Despite these differences, Rbd2 maintains highly conserved structural features characteristic of rhomboid proteases across all kingdoms, including the "GxSG" catalytic motif and the "GxxxG" helix dimerization motif , highlighting the ancient evolutionary origin of these proteases.

The divergence in specific functions while maintaining core catalytic mechanisms exemplifies how orthologous proteins can be repurposed for species-specific cellular processes throughout evolution.

What is the role of Rbd2 in the SREBP pathway in S. pombe?

Rbd2 functions as a critical component in the SREBP activation pathway in S. pombe, participating in a unique proteolytic cascade:

SREBP pathway in S. pombe:

  • The Dsc E3 ligase complex (Dsc1-5) ubiquitinates SREBP precursors (Sre1/Sre2)

  • Cdc48 recognizes ubiquitinated SREBP and recruits it to Rbd2

  • Rbd2 catalyzes the proteolytic cleavage of SREBP within the Golgi membrane

  • Cleaved SREBP transcription factors translocate to the nucleus to activate gene expression

  • This process regulates lipid homeostasis, particularly under low oxygen conditions

Evidence for this model:

  • Mutations in rbd2 lead to defective processing of both Sre1 and Sre2

  • Epistasis analysis places Rbd2 downstream of the Dsc E3 ligase complex

  • Disruption of Rbd2-Cdc48 binding blocks SREBP cleavage

  • Rbd2 localizes to the Golgi apparatus, consistent with its role in SREBP processing

This pathway represents a unique adaptation of the SREBP processing machinery in fission yeast, which differs significantly from the two-step proteolytic processing by Site-1 and Site-2 proteases observed in mammalian cells, highlighting the evolutionary plasticity of this important regulatory pathway.

What experimental designs are suitable for studying the effects of rbd2 mutations on cell physiology?

To comprehensively investigate how rbd2 mutations affect S. pombe cell physiology, researchers should employ a multi-faceted experimental approach:

Experimental design strategies:

  • Time-course experiments:

    • Monitor changes in lipid composition, gene expression, and growth under different conditions

    • Compare wild-type and rbd2 mutant responses to hypoxia or lipid depletion over time

    • Collect samples at regular intervals for comprehensive temporal analysis

  • Genetic interaction screens:

    • Utilize synthetic genetic array (SGA) or similar approach to identify genetic interactions

    • Cross rbd2 mutants with genome-wide deletion library

    • Identify genetic interactions that are synthetic lethal or show epistasis

  • Multi-omics approaches:

    • Transcriptomics: RNA-seq to identify genes dysregulated in rbd2 mutants

    • Lipidomics: Mass spectrometry to quantify changes in cellular lipid profiles

    • Proteomics: Analysis of protein levels and modifications in response to rbd2 mutation

When analyzing results, researchers should employ appropriate statistical methods (ANOVA with post-hoc tests) and present data with clear indications of statistical significance, sample sizes, and measures of variation.

What techniques can be used to visualize Rbd2 localization and dynamics in living S. pombe cells?

Advanced imaging techniques provide powerful tools for studying Rbd2 localization and dynamics in living cells:

Fluorescent protein tagging strategies:

  • C-terminal tagging:

    • Rbd2-6xmCherry fusion has been successfully used to visualize Rbd2 as punctate structures in the Golgi apparatus

    • Ensure tag doesn't interfere with function by conducting complementation tests

  • Split fluorescent protein approaches:

    • BiFC (Bimolecular Fluorescence Complementation) to visualize Rbd2 interactions with binding partners

    • Tag Rbd2 with one half of a split fluorescent protein and potential interactors with the complementary half

Dynamic imaging methods:

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Photobleach Rbd2-FP in a defined region

    • Monitor fluorescence recovery to assess protein mobility within membranes

    • Calculate diffusion coefficients and mobile/immobile fractions

  • Photoactivatable or photoconvertible tags:

    • Use Rbd2 fused to photoactivatable GFP or Dendra2

    • Activate fluorescence in specific cellular regions

    • Track protein movement over time to monitor trafficking

Super-resolution approaches:

  • Structured Illumination Microscopy (SIM):

    • Achieves ~120 nm resolution

    • Suitable for resolving Golgi structures and potential Rbd2 microdomains

  • Single-molecule localization microscopy:

    • PALM/STORM techniques for 20-30 nm resolution

    • Requires photoactivatable/photoswitchable fluorophores

Multi-color imaging:

  • Co-express Rbd2-FP with markers for different Golgi compartments

  • Use organelle-specific dyes to confirm localization

  • Perform time-lapse imaging during stress conditions to observe potential relocalization

The choice of technique should be guided by the specific biological question, with consideration for phototoxicity, expression levels, and potential artifacts from fusion proteins.

How can advanced biochemical approaches be used to identify the substrates and interaction partners of Rbd2?

Identifying the complete set of Rbd2 substrates and interaction partners requires sophisticated biochemical approaches:

Proximity-based labeling methods:

  • TurboID approach:

    • C-terminally tag Rbd2 with BirA TurboID and an internal 3HA tag

    • Validate tag functionality through complementation assays

    • TurboID catalyzes biotin into biotinoyl-5'-AMP, which covalently attaches to proteins in close proximity

    • Isolate biotinylated proteins and identify by mass spectrometry

  • APEX2 proximity labeling:

    • Fuse Rbd2 to APEX2 (engineered ascorbate peroxidase)

    • Treat cells with biotin-phenol and H₂O₂

    • Identify biotinylated proteins by streptavidin pulldown and mass spectrometry

Substrate identification strategies:

  • TAILS (Terminal Amine Isotopic Labeling of Substrates):

    • Compare N-terminomes between wild-type and rbd2Δ cells

    • Identify peptides enriched in wild-type that represent cleavage products

  • Comparative proteomics:

    • Analyze membrane proteomes from wild-type vs. rbd2Δ cells

    • Identify proteins with altered mobility/processing

    • Validate candidates using in vitro cleavage assays

Interactome analysis:

  • Affinity purification-mass spectrometry:

    • Immunoprecipitate tagged Rbd2 under different conditions

    • Identify co-precipitating proteins by mass spectrometry

    • Validate interactions using reciprocal pull-downs or co-immunoprecipitation

  • Cross-linking mass spectrometry:

    • Treat cells with membrane-permeable crosslinkers

    • Purify Rbd2 complexes under denaturing conditions

    • Identify crosslinked peptides by specialized mass spectrometry

Validation approaches:

  • Direct in vitro cleavage assays with recombinant proteins

  • Mutagenesis of predicted cleavage sites

  • Monitoring substrate processing in cells using reporter constructs

These approaches have revealed that Rbd2 interacts with Cdc48 through its SHP box domain, and this interaction is critical for SREBP cleavage .

How does the expression and function of Rbd2 change under different physiological conditions?

Understanding how Rbd2 expression and activity respond to different physiological conditions provides insights into its regulatory mechanisms:

Experimental approaches to study condition-dependent regulation:

  • Transcriptional analysis:

    • qRT-PCR or RNA-seq to measure rbd2+ mRNA levels under different conditions:

      • Hypoxia vs. normoxia

      • Lipid-replete vs. lipid-depleted media

      • Various stress conditions (oxidative, ER stress, etc.)

    • Analysis of rbd2+ promoter elements to identify regulatory sequences

  • Translational and post-translational regulation:

    • Western blotting with anti-Rbd2 antibodies or tagged Rbd2

    • Pulse-chase experiments to measure protein turnover rates

    • Phosphoproteomics to identify condition-dependent phosphorylation

  • Functional assays:

    • Monitor SREBP cleavage efficiency under different conditions

    • Examine Rbd2 localization changes using fluorescent protein fusions

    • Assess protein-protein interactions using co-immunoprecipitation or FRET

Known regulatory mechanisms:

  • The degradation of Rbd2 can be monitored following cycloheximide treatment, which blocks protein synthesis

  • Unlike in mammalian systems, S. pombe Rtf2 turnover does not appear to depend on the proteasomal shuttle protein Mud1 (homolog of human DDI1/2)

These approaches can reveal condition-specific regulation of Rbd2 and provide insights into how cells modulate SREBP pathway activity in response to changing environmental conditions.

What are the advantages and limitations of using S. pombe as a model system for studying rhomboid proteases?

S. pombe offers distinct advantages as a model system for rhomboid protease research while also presenting certain limitations:

Advantages:

  • Genetic tractability:

    • Haploid lifecycle facilitates genetic manipulation

    • Homologous recombination efficiency enables precise genome editing

    • Comprehensive deletion libraries and genetic tools available

    • Temperature-sensitive mutants allow conditional studies

  • Simplified SREBP pathway:

    • S. pombe possesses a SREBP pathway more similar to mammals than S. cerevisiae

    • Fewer redundant proteases compared to mammalian systems

    • Clear phenotypes associated with pathway disruption

  • Evolutionary insights:

    • Position between simple unicellular organisms and complex multicellular eukaryotes

    • Conservation of key cellular processes with higher eukaryotes

    • Distinct features from S. cerevisiae provide complementary insights

  • Technical advantages:

    • Rapid growth and inexpensive cultivation

    • Well-characterized genome

    • Expanding set of research tools and resources

Limitations:

  • Biochemical challenges:

    • Lower biomass yield compared to S. cerevisiae

    • Some difficulty in large-scale protein purification

    • Limited commercial antibodies available

  • Pathway differences:

    • Some aspects of rhomboid function may differ from mammals

    • SREBP processing mechanism differs from the Site-1/Site-2 protease system in mammals

    • Potential absence of certain regulatory mechanisms

  • Technical considerations:

    • Lower transformation efficiency than some model systems

    • More restricted range of selectable markers

    • Fewer commercially available research tools compared to E. coli or S. cerevisiae

Research strategy recommendations:

  • Leverage the genetic tractability for in vivo functional studies

  • Complement with heterologous expression systems for biochemical characterization

  • Use comparative approaches with mammalian systems to identify conserved mechanisms

By understanding these advantages and limitations, researchers can design appropriate experimental strategies for investigating rhomboid proteases using S. pombe as a model system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.