Recombinant Schizosaccharomyces pombe RING finger protein mug145 (mug145)

Shipped with Ice Packs
In Stock

Description

General Information

CategoryDescription
NameRecombinant Full Length Schizosaccharomyces pombe RING finger protein Mug145(Mug145) Protein, His-Tagged
Source OrganismSchizosaccharomyces pombe
Production HostE. coli
TagHis tag (N-terminal)
Protein LengthFull Length (1-309 amino acids)
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Synonymsmug145, meu34, SPAC3A12.03c, RING finger protein mug145, Meiotic expression up-regulated protein 34, Meiotically up-regulated gene 145 protein
UniProt IDP87119
ApplicationsSDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Default glycerol is 50% .

Protein sequence

The amino acid sequence of the Recombinant Full Length Schizosaccharomyces pombe RING finger protein Mug145(Mug145) Protein is :

MPIPKNRPMHVEEEVSSQTNTEILLFALVIILSVIFINFFFFYLCRCCVYFYHTLENQEG
DDERPLIQHHMVNRSTGSLSPSVDRLGNVLGYDIPSRRRRSVVSKEALSCISLEIPYIKW
LKKRKGHAKGESTFLDNRSENQSVIVQGQGETPSVIITYDVRRPNLGSTSFVEMSSALSN
IYNTDASDGDSSDDSCLLEDEEDFCIICYADYAFDDILRVLPCEHVFHTQCIDTWMTTMK
ASCPLCNEDYYKYFLQMDAASSVTHENAAWSIPLSPGDSRTHSAETDRSLLSAMSVRNSR
MPYIVSSTL

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mug145; meu34; SPAC3A12.03c; RING finger protein mug145; Meiotic expression up-regulated protein 34; Meiotically up-regulated gene 145 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mug145
Target Protein Sequence
MPIPKNRPMHVEEEVSSQTNTEILLFALVIILSVIFINFFFFYLCRCCVYFYHTLENQEG DDERPLIQHHMVNRSTGSLSPSVDRLGNVLGYDIPSRRRRSVVSKEALSCISLEIPYIKW LKKRKGHAKGESTFLDNRSENQSVIVQGQGETPSVIITYDVRRPNLGSTSFVEMSSALSN IYNTDASDGDSSDDSCLLEDEEDFCIICYADYAFDDILRVLPCEHVFHTQCIDTWMTTMK ASCPLCNEDYYKYFLQMDAASSVTHENAAWSIPLSPGDSRTHSAETDRSLLSAMSVRNSR MPYIVSSTL
Uniprot No.

Target Background

Function
Plays a role in meiosis.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of the mug145 RING finger protein in S. pombe?

The mug145 protein contains a characteristic RING finger domain, which typically coordinates two zinc ions in a cross-brace structure using cysteine and histidine residues. As a meiosis-upregulated gene product in S. pombe, mug145 likely plays a role in ubiquitin-mediated processes during meiotic division. While specific structural data for mug145 remains limited, research on related mug family proteins such as mug174 demonstrates localization to nuclear structures. The RING finger domain suggests potential E3 ubiquitin ligase activity, though this would require experimental validation through in vitro ubiquitination assays. S. pombe serves as an excellent model organism for studying such proteins due to its well-characterized genetic systems and conserved meiotic pathways with higher eukaryotes .

How does S. pombe serve as a model system for studying RING finger proteins?

Schizosaccharomyces pombe has emerged as a powerful tractable system for studying various cellular processes, including those involving RING finger proteins. Its genome has been fully sequenced, allowing for comprehensive identification of RING domain-containing proteins. S. pombe offers several advantages: a relatively small genome (approximately 12.5 Mb), well-established genetic manipulation techniques, and conservation of many key cellular processes with higher eukaryotes. For studying RING finger proteins specifically, S. pombe provides a simplified system where ubiquitination pathways can be examined with minimal redundancy compared to mammalian systems. Research techniques such as the various genetic assays developed for studying DNA recombination in S. pombe can be adapted to investigate the functional roles of RING finger proteins like mug145 .

What are the key differences between mug145 and other characterized mug family proteins in S. pombe?

The mug (meiosis-upregulated gene) family in S. pombe comprises several proteins that show increased expression during meiosis. While specific comparative data for mug145 is limited in the current literature, recent research on mug174 provides a framework for understanding potential functional differences. Unlike mug174, which has been identified as a Coilin ortholog that forms Cajal body-like nuclear condensates, mug145 contains a RING finger domain suggesting different functional roles. The table below highlights key differences between characterized mug family proteins:

Featuremug145 (RING finger)mug174 (Coilin ortholog)
Primary structureContains RING finger domainContains N-terminal and disordered domains
LocalizationNuclear (predicted)Forms nuclear foci, associates with nucleolus and cleavage body
Primary functionPotential E3 ubiquitin ligase (predicted)Forms Cajal body-like condensates
Interaction partnersUnknownTgs1, U snRNAs (particularly U2 and U5)
Deletion phenotypesNot fully characterizedDefects in growth, meiosis, pre-mRNA splicing, chromosome segregation

Researchers should note that while both are meiosis-upregulated genes, their distinct domain architectures suggest divergent functions in cellular processes .

What expression systems are most effective for producing recombinant mug145 protein?

A methodological approach involves:

  • Cloning the mug145 coding sequence into appropriate vectors with affinity tags

  • Testing expression in multiple systems (bacterial, yeast, insect cells)

  • Optimizing expression conditions (temperature, induction time, media composition)

  • Establishing a purification protocol utilizing affinity chromatography followed by size exclusion chromatography

  • Validating protein folding through circular dichroism or limited proteolysis

For S. pombe proteins specifically, the endogenous expression system using the urg1 promoter offers rapid induction (within 30 minutes) compared to the traditional nmt1 promoter system which requires 14-20 hours for full induction, thus providing a significant advantage for time-sensitive experiments .

What techniques are most useful for studying mug145 localization and dynamics in S. pombe cells?

Investigating the localization and dynamics of mug145 in S. pombe requires multi-faceted approaches combining genomic tagging and advanced microscopy. Based on methodologies employed for other nuclear proteins in S. pombe, researchers should consider:

  • C-terminal or N-terminal tagging with fluorescent proteins (GFP, mCherry) using PCR-based genomic integration

  • Confirmation of tagged protein functionality through complementation of deletion phenotypes

  • Live-cell imaging using spinning disk confocal microscopy for dynamic studies

  • Co-localization studies with known nuclear markers (nucleolus, centromeres, telomeres, SPB)

  • Chromatin immunoprecipitation (ChIP) to identify potential DNA binding sites

  • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility

When designing such experiments, it's crucial to consider that tagging may affect protein function. For nuclear proteins in S. pombe, localization-based screens have successfully identified distinct nuclear bodies, as demonstrated with mug174 which forms discrete nuclear foci. Comparing localization patterns with established nuclear structures (CEN, TEL, SPB, nucleolus, cleavage body) can provide insights into functional associations. For temporal regulation studies, particularly during meiosis, synchronization methods should be employed to capture stage-specific localization patterns .

How can ubiquitination activity of mug145 be effectively assessed in vitro and in vivo?

Assessing the ubiquitination activity of mug145 requires complementary in vitro and in vivo approaches. For a comprehensive analysis:

In vitro ubiquitination assay:

  • Purify recombinant mug145 protein with intact RING domain

  • Assemble reaction containing E1 enzyme, appropriate E2 conjugating enzymes, ubiquitin, ATP, and potential substrates

  • Detect ubiquitination through western blotting with anti-ubiquitin antibodies

  • Include controls with mutated RING domain to confirm specificity

  • Conduct time-course experiments to establish enzyme kinetics

In vivo approaches:

  • Generate S. pombe strains expressing tagged ubiquitin

  • Create wild-type and catalytically inactive mug145 variants

  • Compare ubiquitination profiles through immunoprecipitation and mass spectrometry

  • Utilize cell cycle synchronization to identify stage-specific substrates

  • Employ proximity-dependent labeling methods (BioID or TurboID) to identify proximal protein partners

The experimental design should include comprehensive controls to distinguish direct ubiquitination by mug145 from indirect effects. Researchers can adapt established recombination assays in S. pombe to study the functional consequences of mug145-mediated ubiquitination on DNA repair processes if relevant .

How does mug145 potentially contribute to meiotic recombination in S. pombe?

Based on its classification as a meiosis-upregulated gene and the presence of a RING finger domain, mug145 may play a regulatory role in meiotic recombination through targeted protein ubiquitination. While specific evidence for mug145 function is limited, the methodological approach to investigating this question should include:

  • Analysis of mug145 deletion strains using established recombination assays in S. pombe

  • Quantification of recombination frequencies at hotspots (e.g., ade6-M26) in wild-type versus mug145Δ strains

  • Examination of crossover versus non-crossover outcomes using specialized assays

  • Chromatin immunoprecipitation to identify potential mug145 binding sites during meiosis

  • Identification of potential substrates related to the recombination machinery

S. pombe offers several powerful assays for studying meiotic recombination, including those designed to study recombination at repetitive elements and non-tandem repeats. For instance, the assay developed by Schuchert and Kohli to study crossover frequency represents a methodological approach that could be adapted to investigate mug145's role. Additionally, the ade6-M26 allele, which creates a recombination hotspot, provides a useful tool for quantifying recombination efficiency in the presence or absence of mug145 .

What is known about the interaction network of RING finger proteins in S. pombe, and how might this inform research on mug145?

Understanding the interaction network of RING finger proteins in S. pombe provides context for investigating mug145-specific interactions. While direct interaction data for mug145 remains limited, methodological approaches to mapping its interactome should build upon established techniques:

  • Affinity purification coupled with mass spectrometry (AP-MS) using tagged mug145 as bait

  • Yeast two-hybrid screening against the S. pombe proteome

  • Proximity-dependent biotin labeling (BioID) to identify proximal proteins

  • Co-immunoprecipitation followed by western blotting to validate specific interactions

  • Comparative analysis with interaction networks of other RING finger proteins

Research on related nuclear proteins in S. pombe demonstrates the importance of protein-protein interactions in defining function. For example, mug174 interacts with Tgs1 and U snRNAs, particularly U2 and U5, which informs its role in RNA processing. Similar methodological approaches could reveal whether mug145 functions in isolation or as part of larger protein complexes, potentially in ubiquitin-mediated regulation of meiotic processes .

How can computational approaches enhance structural predictions and functional analysis of mug145?

Computational approaches offer valuable insights for mug145 research when experimental structural data is limited. A comprehensive computational strategy includes:

  • Sequence-based analysis:

    • Multiple sequence alignment with RING domain proteins

    • Identification of conserved catalytic residues

    • Prediction of post-translational modification sites

  • Structural modeling:

    • Homology modeling using related RING finger structures

    • Molecular dynamics simulations to assess stability

    • Docking studies with potential E2 enzymes and substrates

  • Network analysis:

    • Integration of proteomics data with transcriptomics

    • Construction of functional interaction networks

    • Prediction of cellular pathways impacted by mug145

  • Evolutionary analysis:

    • Phylogenetic comparisons across yeast species

    • Identification of selective pressure on functional domains

    • Correlation with meiotic recombination efficiency across species

Computational MethodApplication to mug145Expected Output
AlphaFold2Structural prediction of RING domain3D model with confidence scores
NetPhosPhosphorylation site predictionPotential regulatory sites
UbPredUbiquitination site predictionPotential auto-ubiquitination sites
CLANSClustering with other RING domainsFunctional subfamilies identification
STRINGProtein interaction networkPredicted functional partners

When applying these computational approaches, researchers should validate predictions through targeted experimental designs, particularly for key residues identified in silico as potentially critical for function .

What are common challenges in expressing and purifying functional RING finger proteins like mug145?

Expressing and purifying functional RING finger proteins presents several challenges due to their zinc-coordinating domains. Common issues and methodological solutions include:

  • Protein solubility:

    • Challenge: RING domains often aggregate when overexpressed

    • Solution: Utilize solubility-enhancing tags (MBP, SUMO), lower expression temperature (16-18°C), and optimize buffer conditions with stabilizing agents

  • Zinc coordination:

    • Challenge: Improper folding due to zinc loss during purification

    • Solution: Include 10-50 µM ZnCl₂ in all buffers and minimize exposure to reducing agents that may chelate zinc

  • Protein stability:

    • Challenge: Rapid degradation during purification

    • Solution: Include protease inhibitors, perform purification at 4°C, and minimize freeze-thaw cycles

  • Functional activity:

    • Challenge: Loss of E3 ligase activity during purification

    • Solution: Validate activity immediately after purification, optimize storage conditions, and consider adding stabilizing agents

  • Structural integrity:

    • Challenge: Confirming proper folding of the RING domain

    • Solution: Employ circular dichroism, thermal shift assays, and limited proteolysis to assess structural integrity

For challenging S. pombe proteins, researchers might consider native purification from the organism itself rather than heterologous expression, particularly when investigating complexes or post-translational modifications that might be species-specific .

How can researchers distinguish between direct and indirect effects when analyzing mug145 deletion phenotypes?

Distinguishing direct from indirect effects in mug145 deletion studies requires rigorous experimental design and multiple complementary approaches:

  • Generate complementation strains:

    • Reintroduce wild-type mug145 to confirm phenotype rescue

    • Create catalytically inactive mutants (RING domain mutations) to isolate enzymatic functions

    • Develop separation-of-function mutants to distinguish different protein roles

  • Perform temporal analysis:

    • Use inducible systems like the S. pombe urg1 promoter for rapid induction (30 minutes)

    • Conduct time-course experiments to identify primary versus secondary effects

    • Compare phenotype onset timing with molecular events

  • Implement epistasis analysis:

    • Generate double mutants with genes in potential pathways

    • Determine whether phenotypes are additive, synergistic, or epistatic

    • Map genetic interactions to place mug145 in cellular pathways

  • Utilize domain-specific approaches:

    • Create chimeric proteins with domains from related RING proteins

    • Identify critical regions through systematic truncation analysis

    • Correlate domain function with specific phenotypic outcomes

When analyzing meiotic phenotypes specifically, researchers should consider the pleiotropic effects observed with other mug family proteins. For example, deletion of mug174 causes diverse phenotypes including defects in vegetative growth, meiosis, pre-mRNA splicing, and chromosome segregation, suggesting involvement in multiple cellular processes. Similar comprehensive phenotypic analysis would be valuable for mug145 .

What controls should be included when studying mug145 ubiquitination targets and specificity?

Rigorous control experiments are essential when investigating mug145 ubiquitination targets to ensure specificity and biological relevance:

Experimental controls for in vitro ubiquitination:

  • Enzyme controls:

    • Catalytically inactive mug145 (RING domain mutant)

    • Reactions missing individual components (E1, E2, ATP)

    • E2 enzyme panel to determine conjugating enzyme specificity

  • Substrate controls:

    • Known ubiquitination substrates as positive controls

    • Mutated substrate binding sites to confirm specificity

    • Competition assays with unlabeled substrates

  • Ubiquitin variants:

    • Lysine-mutant ubiquitin to determine chain types (K48, K63, etc.)

    • Tagged ubiquitin for detection specificity

    • Methylated ubiquitin to restrict chain formation

Controls for in vivo studies:

  • Genetic controls:

    • mug145Δ strains complemented with wild-type or mutant alleles

    • Strains with altered expression levels to establish dose-dependence

    • Cell-cycle synchronized cultures to control for temporal effects

  • Specificity controls:

    • Parallel analysis of related RING finger proteins

    • Comparison with general ubiquitination perturbation (e.g., proteasome inhibition)

    • Validation in multiple strain backgrounds

  • Technical controls:

    • Input normalization for immunoprecipitation experiments

    • Reciprocal tagging strategies (N-terminal vs. C-terminal)

    • Sample preparation controls to prevent post-lysis modifications

The inclusion of these controls helps distinguish physiologically relevant ubiquitination events from experimental artifacts and provides confidence in target identification .

How might emerging methodologies enhance our understanding of mug145 function in S. pombe?

Emerging methodologies present exciting opportunities to advance understanding of mug145 function through more precise, dynamic, and comprehensive approaches:

  • CRISPR/Cas9-based technologies:

    • Base editing for generating precise point mutations without double-strand breaks

    • CRISPRi/CRISPRa for tunable gene expression modulation

    • CRISPR screening in S. pombe for genetic interaction mapping

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize mug145 localization at nanometer resolution

    • Single-molecule tracking to monitor dynamic behavior in living cells

    • Correlative light and electron microscopy to contextualize localization within nuclear ultrastructure

  • Proteomics innovations:

    • Proximity-dependent labeling with engineered peroxidases for in vivo interaction mapping

    • Cross-linking mass spectrometry to capture transient protein interactions

    • Targeted proteomics for quantitative analysis of low-abundance modifications

  • Systems biology approaches:

    • Integration of multi-omics data (transcriptomics, proteomics, metabolomics)

    • Network modeling of mug145-dependent processes

    • Machine learning for phenotypic analysis of complex datasets

  • In vitro reconstitution:

    • Cell-free expression systems for functional reconstitution

    • Synthetic biology approaches to build minimal systems

    • Microfluidics for high-throughput biochemical analyses

These methodologies could be particularly valuable for understanding dynamic processes during meiosis, where mug145 likely plays important roles. The rapid induction system based on the urg1 promoter in S. pombe, which allows expression within 30 minutes (similar to S. cerevisiae GAL induction), provides an excellent tool for temporal studies of mug145 function .

What insights might comparative analysis of mug145 with related proteins in other organisms provide?

Comparative analysis across species can provide evolutionary context and functional insights for mug145 research:

  • Ortholog identification and analysis:

    • Comprehensive sequence analysis across fungal species

    • Identification of conserved structural elements versus lineage-specific features

    • Correlation of evolutionary conservation with functional importance

  • Functional complementation studies:

    • Expression of mug145 orthologs from different species in S. pombe

    • Testing whether human RING finger proteins can functionally replace mug145

    • Identification of species-specific versus conserved functions

  • Comparative phenotypic analysis:

    • Systematic comparison of deletion phenotypes across species

    • Identification of conserved cellular processes affected by orthologs

    • Correlation with differences in meiotic recombination strategies

  • Structural conservation analysis:

    • Comparison of RING domain structures across species

    • Identification of conserved interaction surfaces

    • Analysis of substrate recognition mechanisms

The approach of expressing human orthologs in S. pombe has proven valuable in other contexts, as demonstrated by studies with human Coilin expressed in fission yeast. While human Coilin formed nuclear foci when expressed in S. pombe and colocalized with Mug174, it could not rescue the growth defect in mug174Δ strains, suggesting significant functional divergence despite structural similarities. A similar approach with mug145 could reveal the degree of functional conservation of RING finger proteins across evolutionary distances .

What potential therapeutic applications might arise from understanding mug145 function and its human orthologs?

While basic research on S. pombe mug145 focuses on fundamental cellular mechanisms, insights gained may inform therapeutic approaches through understanding conserved pathways:

  • Cancer biology applications:

    • RING finger proteins often regulate cell cycle and DNA repair pathways

    • Understanding mug145's role in genome stability may inform cancer mechanisms

    • Identification of druggable nodes in conserved ubiquitination pathways

  • Reproductive medicine relevance:

    • Meiotic proteins impact gamete formation and fertility

    • Insights into mug145's role in meiosis may inform causes of infertility

    • Potential diagnostic markers for meiotic defects

  • Neurodegenerative disease connections:

    • Protein homeostasis dysregulation underlies many neurodegenerative conditions

    • E3 ligase pathways represent potential therapeutic targets

    • Cellular quiescence mechanisms (as seen with related protein mug174) may inform neuronal maintenance strategies

  • Drug development opportunities:

    • RING E3 ligases represent an emerging class of druggable targets

    • Structural insights from mug145 may inform inhibitor design

    • Targeted protein degradation approaches (PROTACs) often utilize E3 ligase machinery

  • Cellular quiescence applications:

    • Understanding protein function in cellular quiescence (as demonstrated for mug174) has implications for stem cell biology and cancer

    • Maintenance of and transition from cellular quiescence is critical in preventing human diseases

    • Cajal body dysfunction has been linked to conditions such as spinal muscular atrophy and dyskeratosis congenita

Research on model organisms like S. pombe continues to provide fundamental insights that ultimately inform human disease mechanisms. The finding that Mug174 is indispensable for cellular quiescence suggests that related proteins may have similarly important roles in cellular homeostasis with potential implications for human health .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.