The amino acid sequence of the Recombinant Full Length Schizosaccharomyces pombe RING finger protein Mug145(Mug145) Protein is :
MPIPKNRPMHVEEEVSSQTNTEILLFALVIILSVIFINFFFFYLCRCCVYFYHTLENQEG
DDERPLIQHHMVNRSTGSLSPSVDRLGNVLGYDIPSRRRRSVVSKEALSCISLEIPYIKW
LKKRKGHAKGESTFLDNRSENQSVIVQGQGETPSVIITYDVRRPNLGSTSFVEMSSALSN
IYNTDASDGDSSDDSCLLEDEEDFCIICYADYAFDDILRVLPCEHVFHTQCIDTWMTTMK
ASCPLCNEDYYKYFLQMDAASSVTHENAAWSIPLSPGDSRTHSAETDRSLLSAMSVRNSR
MPYIVSSTL
KEGG: spo:SPAC3A12.03c
STRING: 4896.SPAC3A12.03c.1
The mug145 protein contains a characteristic RING finger domain, which typically coordinates two zinc ions in a cross-brace structure using cysteine and histidine residues. As a meiosis-upregulated gene product in S. pombe, mug145 likely plays a role in ubiquitin-mediated processes during meiotic division. While specific structural data for mug145 remains limited, research on related mug family proteins such as mug174 demonstrates localization to nuclear structures. The RING finger domain suggests potential E3 ubiquitin ligase activity, though this would require experimental validation through in vitro ubiquitination assays. S. pombe serves as an excellent model organism for studying such proteins due to its well-characterized genetic systems and conserved meiotic pathways with higher eukaryotes .
Schizosaccharomyces pombe has emerged as a powerful tractable system for studying various cellular processes, including those involving RING finger proteins. Its genome has been fully sequenced, allowing for comprehensive identification of RING domain-containing proteins. S. pombe offers several advantages: a relatively small genome (approximately 12.5 Mb), well-established genetic manipulation techniques, and conservation of many key cellular processes with higher eukaryotes. For studying RING finger proteins specifically, S. pombe provides a simplified system where ubiquitination pathways can be examined with minimal redundancy compared to mammalian systems. Research techniques such as the various genetic assays developed for studying DNA recombination in S. pombe can be adapted to investigate the functional roles of RING finger proteins like mug145 .
The mug (meiosis-upregulated gene) family in S. pombe comprises several proteins that show increased expression during meiosis. While specific comparative data for mug145 is limited in the current literature, recent research on mug174 provides a framework for understanding potential functional differences. Unlike mug174, which has been identified as a Coilin ortholog that forms Cajal body-like nuclear condensates, mug145 contains a RING finger domain suggesting different functional roles. The table below highlights key differences between characterized mug family proteins:
| Feature | mug145 (RING finger) | mug174 (Coilin ortholog) |
|---|---|---|
| Primary structure | Contains RING finger domain | Contains N-terminal and disordered domains |
| Localization | Nuclear (predicted) | Forms nuclear foci, associates with nucleolus and cleavage body |
| Primary function | Potential E3 ubiquitin ligase (predicted) | Forms Cajal body-like condensates |
| Interaction partners | Unknown | Tgs1, U snRNAs (particularly U2 and U5) |
| Deletion phenotypes | Not fully characterized | Defects in growth, meiosis, pre-mRNA splicing, chromosome segregation |
Researchers should note that while both are meiosis-upregulated genes, their distinct domain architectures suggest divergent functions in cellular processes .
A methodological approach involves:
Cloning the mug145 coding sequence into appropriate vectors with affinity tags
Testing expression in multiple systems (bacterial, yeast, insect cells)
Optimizing expression conditions (temperature, induction time, media composition)
Establishing a purification protocol utilizing affinity chromatography followed by size exclusion chromatography
Validating protein folding through circular dichroism or limited proteolysis
For S. pombe proteins specifically, the endogenous expression system using the urg1 promoter offers rapid induction (within 30 minutes) compared to the traditional nmt1 promoter system which requires 14-20 hours for full induction, thus providing a significant advantage for time-sensitive experiments .
Investigating the localization and dynamics of mug145 in S. pombe requires multi-faceted approaches combining genomic tagging and advanced microscopy. Based on methodologies employed for other nuclear proteins in S. pombe, researchers should consider:
C-terminal or N-terminal tagging with fluorescent proteins (GFP, mCherry) using PCR-based genomic integration
Confirmation of tagged protein functionality through complementation of deletion phenotypes
Live-cell imaging using spinning disk confocal microscopy for dynamic studies
Co-localization studies with known nuclear markers (nucleolus, centromeres, telomeres, SPB)
Chromatin immunoprecipitation (ChIP) to identify potential DNA binding sites
Fluorescence recovery after photobleaching (FRAP) to assess protein mobility
When designing such experiments, it's crucial to consider that tagging may affect protein function. For nuclear proteins in S. pombe, localization-based screens have successfully identified distinct nuclear bodies, as demonstrated with mug174 which forms discrete nuclear foci. Comparing localization patterns with established nuclear structures (CEN, TEL, SPB, nucleolus, cleavage body) can provide insights into functional associations. For temporal regulation studies, particularly during meiosis, synchronization methods should be employed to capture stage-specific localization patterns .
Assessing the ubiquitination activity of mug145 requires complementary in vitro and in vivo approaches. For a comprehensive analysis:
In vitro ubiquitination assay:
Purify recombinant mug145 protein with intact RING domain
Assemble reaction containing E1 enzyme, appropriate E2 conjugating enzymes, ubiquitin, ATP, and potential substrates
Detect ubiquitination through western blotting with anti-ubiquitin antibodies
Include controls with mutated RING domain to confirm specificity
Conduct time-course experiments to establish enzyme kinetics
In vivo approaches:
Generate S. pombe strains expressing tagged ubiquitin
Create wild-type and catalytically inactive mug145 variants
Compare ubiquitination profiles through immunoprecipitation and mass spectrometry
Utilize cell cycle synchronization to identify stage-specific substrates
Employ proximity-dependent labeling methods (BioID or TurboID) to identify proximal protein partners
The experimental design should include comprehensive controls to distinguish direct ubiquitination by mug145 from indirect effects. Researchers can adapt established recombination assays in S. pombe to study the functional consequences of mug145-mediated ubiquitination on DNA repair processes if relevant .
Based on its classification as a meiosis-upregulated gene and the presence of a RING finger domain, mug145 may play a regulatory role in meiotic recombination through targeted protein ubiquitination. While specific evidence for mug145 function is limited, the methodological approach to investigating this question should include:
Analysis of mug145 deletion strains using established recombination assays in S. pombe
Quantification of recombination frequencies at hotspots (e.g., ade6-M26) in wild-type versus mug145Δ strains
Examination of crossover versus non-crossover outcomes using specialized assays
Chromatin immunoprecipitation to identify potential mug145 binding sites during meiosis
Identification of potential substrates related to the recombination machinery
S. pombe offers several powerful assays for studying meiotic recombination, including those designed to study recombination at repetitive elements and non-tandem repeats. For instance, the assay developed by Schuchert and Kohli to study crossover frequency represents a methodological approach that could be adapted to investigate mug145's role. Additionally, the ade6-M26 allele, which creates a recombination hotspot, provides a useful tool for quantifying recombination efficiency in the presence or absence of mug145 .
Understanding the interaction network of RING finger proteins in S. pombe provides context for investigating mug145-specific interactions. While direct interaction data for mug145 remains limited, methodological approaches to mapping its interactome should build upon established techniques:
Affinity purification coupled with mass spectrometry (AP-MS) using tagged mug145 as bait
Yeast two-hybrid screening against the S. pombe proteome
Proximity-dependent biotin labeling (BioID) to identify proximal proteins
Co-immunoprecipitation followed by western blotting to validate specific interactions
Comparative analysis with interaction networks of other RING finger proteins
Research on related nuclear proteins in S. pombe demonstrates the importance of protein-protein interactions in defining function. For example, mug174 interacts with Tgs1 and U snRNAs, particularly U2 and U5, which informs its role in RNA processing. Similar methodological approaches could reveal whether mug145 functions in isolation or as part of larger protein complexes, potentially in ubiquitin-mediated regulation of meiotic processes .
Computational approaches offer valuable insights for mug145 research when experimental structural data is limited. A comprehensive computational strategy includes:
Sequence-based analysis:
Multiple sequence alignment with RING domain proteins
Identification of conserved catalytic residues
Prediction of post-translational modification sites
Structural modeling:
Homology modeling using related RING finger structures
Molecular dynamics simulations to assess stability
Docking studies with potential E2 enzymes and substrates
Network analysis:
Integration of proteomics data with transcriptomics
Construction of functional interaction networks
Prediction of cellular pathways impacted by mug145
Evolutionary analysis:
Phylogenetic comparisons across yeast species
Identification of selective pressure on functional domains
Correlation with meiotic recombination efficiency across species
| Computational Method | Application to mug145 | Expected Output |
|---|---|---|
| AlphaFold2 | Structural prediction of RING domain | 3D model with confidence scores |
| NetPhos | Phosphorylation site prediction | Potential regulatory sites |
| UbPred | Ubiquitination site prediction | Potential auto-ubiquitination sites |
| CLANS | Clustering with other RING domains | Functional subfamilies identification |
| STRING | Protein interaction network | Predicted functional partners |
When applying these computational approaches, researchers should validate predictions through targeted experimental designs, particularly for key residues identified in silico as potentially critical for function .
Expressing and purifying functional RING finger proteins presents several challenges due to their zinc-coordinating domains. Common issues and methodological solutions include:
Protein solubility:
Challenge: RING domains often aggregate when overexpressed
Solution: Utilize solubility-enhancing tags (MBP, SUMO), lower expression temperature (16-18°C), and optimize buffer conditions with stabilizing agents
Zinc coordination:
Challenge: Improper folding due to zinc loss during purification
Solution: Include 10-50 µM ZnCl₂ in all buffers and minimize exposure to reducing agents that may chelate zinc
Protein stability:
Challenge: Rapid degradation during purification
Solution: Include protease inhibitors, perform purification at 4°C, and minimize freeze-thaw cycles
Functional activity:
Challenge: Loss of E3 ligase activity during purification
Solution: Validate activity immediately after purification, optimize storage conditions, and consider adding stabilizing agents
Structural integrity:
Challenge: Confirming proper folding of the RING domain
Solution: Employ circular dichroism, thermal shift assays, and limited proteolysis to assess structural integrity
For challenging S. pombe proteins, researchers might consider native purification from the organism itself rather than heterologous expression, particularly when investigating complexes or post-translational modifications that might be species-specific .
Distinguishing direct from indirect effects in mug145 deletion studies requires rigorous experimental design and multiple complementary approaches:
Generate complementation strains:
Reintroduce wild-type mug145 to confirm phenotype rescue
Create catalytically inactive mutants (RING domain mutations) to isolate enzymatic functions
Develop separation-of-function mutants to distinguish different protein roles
Perform temporal analysis:
Use inducible systems like the S. pombe urg1 promoter for rapid induction (30 minutes)
Conduct time-course experiments to identify primary versus secondary effects
Compare phenotype onset timing with molecular events
Implement epistasis analysis:
Generate double mutants with genes in potential pathways
Determine whether phenotypes are additive, synergistic, or epistatic
Map genetic interactions to place mug145 in cellular pathways
Utilize domain-specific approaches:
Create chimeric proteins with domains from related RING proteins
Identify critical regions through systematic truncation analysis
Correlate domain function with specific phenotypic outcomes
When analyzing meiotic phenotypes specifically, researchers should consider the pleiotropic effects observed with other mug family proteins. For example, deletion of mug174 causes diverse phenotypes including defects in vegetative growth, meiosis, pre-mRNA splicing, and chromosome segregation, suggesting involvement in multiple cellular processes. Similar comprehensive phenotypic analysis would be valuable for mug145 .
Rigorous control experiments are essential when investigating mug145 ubiquitination targets to ensure specificity and biological relevance:
Experimental controls for in vitro ubiquitination:
Enzyme controls:
Catalytically inactive mug145 (RING domain mutant)
Reactions missing individual components (E1, E2, ATP)
E2 enzyme panel to determine conjugating enzyme specificity
Substrate controls:
Known ubiquitination substrates as positive controls
Mutated substrate binding sites to confirm specificity
Competition assays with unlabeled substrates
Ubiquitin variants:
Lysine-mutant ubiquitin to determine chain types (K48, K63, etc.)
Tagged ubiquitin for detection specificity
Methylated ubiquitin to restrict chain formation
Controls for in vivo studies:
Genetic controls:
mug145Δ strains complemented with wild-type or mutant alleles
Strains with altered expression levels to establish dose-dependence
Cell-cycle synchronized cultures to control for temporal effects
Specificity controls:
Parallel analysis of related RING finger proteins
Comparison with general ubiquitination perturbation (e.g., proteasome inhibition)
Validation in multiple strain backgrounds
Technical controls:
Input normalization for immunoprecipitation experiments
Reciprocal tagging strategies (N-terminal vs. C-terminal)
Sample preparation controls to prevent post-lysis modifications
The inclusion of these controls helps distinguish physiologically relevant ubiquitination events from experimental artifacts and provides confidence in target identification .
Emerging methodologies present exciting opportunities to advance understanding of mug145 function through more precise, dynamic, and comprehensive approaches:
CRISPR/Cas9-based technologies:
Base editing for generating precise point mutations without double-strand breaks
CRISPRi/CRISPRa for tunable gene expression modulation
CRISPR screening in S. pombe for genetic interaction mapping
Advanced imaging techniques:
Super-resolution microscopy to visualize mug145 localization at nanometer resolution
Single-molecule tracking to monitor dynamic behavior in living cells
Correlative light and electron microscopy to contextualize localization within nuclear ultrastructure
Proteomics innovations:
Proximity-dependent labeling with engineered peroxidases for in vivo interaction mapping
Cross-linking mass spectrometry to capture transient protein interactions
Targeted proteomics for quantitative analysis of low-abundance modifications
Systems biology approaches:
Integration of multi-omics data (transcriptomics, proteomics, metabolomics)
Network modeling of mug145-dependent processes
Machine learning for phenotypic analysis of complex datasets
In vitro reconstitution:
Cell-free expression systems for functional reconstitution
Synthetic biology approaches to build minimal systems
Microfluidics for high-throughput biochemical analyses
These methodologies could be particularly valuable for understanding dynamic processes during meiosis, where mug145 likely plays important roles. The rapid induction system based on the urg1 promoter in S. pombe, which allows expression within 30 minutes (similar to S. cerevisiae GAL induction), provides an excellent tool for temporal studies of mug145 function .
Comparative analysis across species can provide evolutionary context and functional insights for mug145 research:
Ortholog identification and analysis:
Comprehensive sequence analysis across fungal species
Identification of conserved structural elements versus lineage-specific features
Correlation of evolutionary conservation with functional importance
Functional complementation studies:
Expression of mug145 orthologs from different species in S. pombe
Testing whether human RING finger proteins can functionally replace mug145
Identification of species-specific versus conserved functions
Comparative phenotypic analysis:
Systematic comparison of deletion phenotypes across species
Identification of conserved cellular processes affected by orthologs
Correlation with differences in meiotic recombination strategies
Structural conservation analysis:
Comparison of RING domain structures across species
Identification of conserved interaction surfaces
Analysis of substrate recognition mechanisms
The approach of expressing human orthologs in S. pombe has proven valuable in other contexts, as demonstrated by studies with human Coilin expressed in fission yeast. While human Coilin formed nuclear foci when expressed in S. pombe and colocalized with Mug174, it could not rescue the growth defect in mug174Δ strains, suggesting significant functional divergence despite structural similarities. A similar approach with mug145 could reveal the degree of functional conservation of RING finger proteins across evolutionary distances .
While basic research on S. pombe mug145 focuses on fundamental cellular mechanisms, insights gained may inform therapeutic approaches through understanding conserved pathways:
Cancer biology applications:
RING finger proteins often regulate cell cycle and DNA repair pathways
Understanding mug145's role in genome stability may inform cancer mechanisms
Identification of druggable nodes in conserved ubiquitination pathways
Reproductive medicine relevance:
Meiotic proteins impact gamete formation and fertility
Insights into mug145's role in meiosis may inform causes of infertility
Potential diagnostic markers for meiotic defects
Neurodegenerative disease connections:
Protein homeostasis dysregulation underlies many neurodegenerative conditions
E3 ligase pathways represent potential therapeutic targets
Cellular quiescence mechanisms (as seen with related protein mug174) may inform neuronal maintenance strategies
Drug development opportunities:
RING E3 ligases represent an emerging class of druggable targets
Structural insights from mug145 may inform inhibitor design
Targeted protein degradation approaches (PROTACs) often utilize E3 ligase machinery
Cellular quiescence applications:
Understanding protein function in cellular quiescence (as demonstrated for mug174) has implications for stem cell biology and cancer
Maintenance of and transition from cellular quiescence is critical in preventing human diseases
Cajal body dysfunction has been linked to conditions such as spinal muscular atrophy and dyskeratosis congenita
Research on model organisms like S. pombe continues to provide fundamental insights that ultimately inform human disease mechanisms. The finding that Mug174 is indispensable for cellular quiescence suggests that related proteins may have similarly important roles in cellular homeostasis with potential implications for human health .