Recombinant Schizosaccharomyces pombe Rsm22-cox11 tandem protein 1, mitochondrial (cox1101)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
cox1101; cox11; cox11-a; SPAC1420.04c; SPAPB17E12.01c; Rsm22-cox11 tandem protein 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
569-753
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
cox1101
Target Protein Sequence
TTIYYLVAISIFALGLTYAAVPLYRLFCSKTGYGGTLNTDQSRMNAERMVPRKDNKRIRV TFNGDVAGNLSWKLWPQQREIYVLPGETALGFYTAENTSDHDIVGVATYNIVPGQAAVYF SKVACFCFEEQKLDAHEKVDLPVFFFIDPEFADDPNMKDIDDILLSYTFFEARYDTNGNL LTKLN
Uniprot No.

Target Background

Function
Rsm22-1 participates in mitochondrion-encoded protein synthesis. Cox11-1 functions in a late stage of cytochrome c oxidase synthesis, likely by facilitating copper B insertion into subunit I.
Gene References Into Functions
  1. The tandem arrangement of pre-Rsm22-Cox11 does not produce a persistent fusion protein but may enhance Cox11 import efficiency and/or coordinate Rsm22 and Cox11 expression levels in *S. pombe*. PMID: 16835444
Database Links
Protein Families
Methyltransferase superfamily, Rsm22 family; COX11/CtaG family
Subcellular Location
[37S ribosomal protein S22-1]: Mitochondrion matrix.; [Cytochrome c oxidase assembly protein cox11-1]: Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side.

Q&A

What is the Rsm22-Cox11 tandem protein in S. pombe?

The Rsm22-Cox11 tandem protein is a fusion protein encoded by a single gene in Schizosaccharomyces pombe. This mitochondrial protein consists of two distinct functional domains: Rsm22, which is a component of the mitochondrial ribosome, and Cox11, which functions as a factor required for copper insertion into cytochrome oxidase. The protein is initially synthesized as a precursor (pre-Rsm22-Cox11) containing a mitochondrial targeting sequence at its N-terminus . This tandem organization is relatively uncommon, as in most other organisms including the related yeast Saccharomyces cerevisiae, these proteins are encoded by separate genes .

How is the pre-Rsm22-Cox11 protein processed after synthesis?

The pre-Rsm22-Cox11 tandem protein undergoes sequential processing through at least two distinct steps:

  • First processing step: The mitochondrial presequence is removed by the mitochondrial processing peptidase (MPP) early during or after import into mitochondria.

  • Second processing step: At a later stage of the import process, the Rsm22 and Cox11 domains are separated by a second cleavage event, also catalyzed by MPP, which recognizes an internal processing site that resembles a classical mitochondrial presequence .

This sequential processing results in three distinct polypeptides: the cleaved N-terminal presequence, the mature Rsm22 domain, and the mature Cox11 domain. In vivo studies using tagged versions of pre-Rsm22-Cox11 have confirmed this complete separation of the two functional domains .

What is the subcellular localization of the processed Rsm22 and Cox11 domains?

After processing, the mature proteins assume distinct localizations within the mitochondria:

  • Rsm22: Becomes incorporated into the mitochondrial ribosome as a component of the small subunit in the mitochondrial matrix.

  • Cox11: Becomes anchored in the inner mitochondrial membrane via an N-terminal transmembrane domain, with its large copper-binding domain exposed to the intermembrane space .

This distinct localization is essential for their respective functions in protein synthesis and copper insertion into cytochrome oxidase. Protease protection assays with tagged versions of Cox11 confirm this topology, as the C-terminal domain is accessible to proteases only when the outer membrane is disrupted or when detergents are added to lyse the mitochondria .

What evolutionary significance does the tandem arrangement of Rsm22-Cox11 have?

The tandem organization of Rsm22 and Cox11 in S. pombe represents an interesting case of gene fusion that is not conserved in related species. While the functional significance remains under investigation, several hypotheses have been proposed:

Complementation studies have shown that an artificial fusion of S. cerevisiae Rsm22 and Cox11 that mimics the S. pombe arrangement can fully complement both RSM22 and COX11 deletion mutants, suggesting that the fusion doesn't interfere with the functions of either domain .

How does oxidative stress affect the function of proteins involved in cytochrome c oxidase biogenesis?

While not directly studied for Rsm22-Cox11, research on related proteins in the cytochrome c oxidase (COX) assembly pathway provides insight into redox regulation. For example, in S. cerevisiae, Mss51 (a COX1 mRNA-specific processing factor and translational activator) is sensitive to oxidative stress:

  • Under oxidative conditions, hydrogen peroxide (H₂O₂) induces the formation of disulfide bonds in Mss51, particularly involving CPX motif heme-coordinating cysteines.

  • This oxidation results in a heme ligand switch that lowers heme-binding affinity and promotes its release.

  • Consequently, Mss51-dependent functions in COX1 mRNA processing and translation are compromised.

  • This represents a mechanism by which oxidative stress attenuates Cox1 synthesis and potentially COX assembly .

Given that Cox11 also contains metal-binding domains and is involved in metalation of COX, it may be subject to similar redox regulation mechanisms, though specific studies on the S. pombe Rsm22-Cox11 protein would be needed to confirm this.

What experimental approaches can be used to study recombination in mitochondrial genomes containing the Rsm22-Cox11 sequence?

Based on techniques used in mitochondrial DNA recombination studies, several approaches could be applied to study recombination involving the Rsm22-Cox11 sequence:

  • Selection-based approaches: Creating heteroplasmic lines containing different mitochondrial genomes, then applying selective pressures that favor recombinant genomes. This has been successfully used in Drosophila studies .

  • Double-strand break induction: Introducing restriction enzymes targeted to mitochondria can create specific double-strand breaks that enhance recombination rates. This approach can be regulated using tissue-specific or inducible expression systems .

  • Detection methods:

    • Southern blotting with probes specific to the Rsm22-Cox11 region

    • PCR-based approaches to amplify potential recombination junctions

    • Next-generation sequencing to identify recombination breakpoints with high resolution

  • In vivo tagging: Expression of tagged versions of the Rsm22-Cox11 protein can help track processing and localization, as demonstrated in studies using HA-tagged constructs .

TechniqueApplicationAdvantagesLimitations
Southern blottingDetection of recombinant genomic fragmentsVisualizes specific fragments, relatively simpleLower resolution, requires considerable amount of DNA
PCR-based detectionAmplification of recombination junctionsHigh sensitivity, can detect rare eventsMay introduce artifacts, primer design critical
Next-generation sequencingGenome-wide recombination mappingHigh resolution, unbiasedCostly, complex data analysis
Restriction enzyme-induced DSBsEnhancing recombination ratesCan target specific sites, inducibleMay cause unwanted genomic damage
Tagged protein expressionTracking protein processingFollows fate of specific proteinsTag may affect protein function

How can researchers clone and express the Rsm22-Cox11 tandem protein for functional studies?

To clone and express the Rsm22-Cox11 tandem protein, researchers can follow these methodological steps:

  • Gene amplification: The complete open reading frame can be amplified using PCR with primers containing appropriate restriction sites. For example, based on published studies, primers could include sequences like:

    • Forward: 5′-TAT TTA GGA TCC ATG CCC ATT CTA ACA TGC AG-3′

    • Reverse: 5′-TAT TTA GAA TTC TCA GTT GAG TTT AGT TAA AAG ATT G-3′

  • Vector construction: The amplified fragment can be digested with appropriate restriction enzymes (e.g., BamHI and EcoRI) and cloned into expression vectors like pGEM3 or pGEM4 for in vitro studies, or into yeast expression vectors like pJR1-3XL for in vivo studies .

  • Epitope tagging: For tracking the protein, epitope tags such as HA can be introduced using overlap extension PCR. A triple HA tag can be incorporated at the C-terminus using appropriate primers:

    • Overlap primers: 5′-GGC AAT CTT TTA ACT AAA CTC AAC CTG GTT CCG CGT GGA-3′ and 5′-TCC ACG CGG AAC CAG GTT GAG TTT AGT TTA AAG ATT GCC-3′

    • Flanking primers containing restriction sites for subsequent cloning

  • Truncation constructs: To study specific domains, truncated versions can be created, such as pre-Rsm22-Cox11ΔC lacking the C-terminal 54 amino acid residues, by digestion with appropriate restriction enzymes (e.g., SpeI) followed by religation .

  • Expression and purification: For in vitro studies, the protein can be expressed in rabbit reticulocyte lysate systems in the presence of [³⁵S]methionine for radiolabeling, followed by import assays with isolated mitochondria.

What techniques can be used to study the processing and import of pre-Rsm22-Cox11 into mitochondria?

Several established techniques can be employed to investigate the processing and mitochondrial import of pre-Rsm22-Cox11:

  • In vitro import assays:

    • Synthesize radiolabeled precursor protein using in vitro transcription/translation systems

    • Isolate mitochondria from appropriate yeast strains

    • Incubate precursor with isolated mitochondria under various conditions

    • Analyze processing by SDS-PAGE and autoradiography

    • Perform protease protection assays to determine topology

  • Processing site identification:

    • Create mutant versions with alterations in potential cleavage sites

    • Perform N-terminal sequencing of processed fragments

    • Use mass spectrometry to determine precise cleavage sites

  • Subcellular fractionation:

    • Separate mitochondrial subcompartments (outer membrane, intermembrane space, inner membrane, matrix)

    • Analyze distribution of processed fragments by immunoblotting

  • In vivo analysis:

    • Express epitope-tagged versions in yeast

    • Monitor processing by immunoblotting

    • Perform immunoprecipitation to identify interaction partners

    • Use fluorescence microscopy with GFP-tagged constructs to visualize localization

An example experimental workflow used successfully in published studies included:

  • Creating a strain expressing C-terminally HA-tagged pre-Rsm22-Cox11

  • Isolating mitochondria from this strain

  • Performing protease protection assays with and without detergent treatment

  • Analyzing results by Western blotting using antibodies against the HA tag and control proteins (cytochrome c₁, aconitase)

How can researchers determine the functional significance of the tandem arrangement versus separate proteins?

To assess whether the tandem arrangement provides any functional advantages compared to separately expressed proteins, researchers can employ several complementary approaches:

  • Complementation studies:

    • Create yeast strains with deletions of endogenous genes

    • Transform with constructs expressing either the tandem protein or separate proteins

    • Compare growth rates, respiratory capacity, and cytochrome oxidase activity

  • Protein stability and abundance measurements:

    • Use pulse-chase experiments to compare turnover rates

    • Quantify steady-state levels by Western blotting

    • Employ ribosome profiling to assess translation efficiency

  • Import efficiency comparison:

    • Perform in vitro import assays comparing import kinetics of the tandem precursor versus separate precursors

    • Measure energetic requirements for import

    • Assess dependence on various import machinery components

  • Protein-protein interaction studies:

    • Use co-immunoprecipitation to identify interaction partners

    • Perform blue native PAGE to analyze complex formation

    • Apply proximity labeling techniques (BioID, APEX) to map the interactome

  • Oxidative stress response:

    • Subject cells to various oxidative stressors

    • Monitor effects on protein processing, stability, and function

    • Compare responses between tandem and separate protein-expressing strains

Experimental ApproachMeasurementExpected Outcome if Tandem Arrangement is Advantageous
Growth curve analysisDoubling timeFaster growth for tandem protein expression under respiratory conditions
Oxygen consumptionRespiratory capacityHigher oxygen consumption rates with tandem protein
In vitro import assaysImport efficiencyMore efficient import of tandem precursor
Pulse-chase analysisProtein stabilityDifferent turnover rates between tandem and separate proteins
Co-immunoprecipitationProtein interactionsEnhanced or altered interaction profile for tandem protein
Oxidative stress challengeSurvival rateBetter tolerance to oxidative stress with tandem protein

How do researchers resolve contradictions in experimental data regarding Rsm22-Cox11 processing?

When faced with contradictory results regarding Rsm22-Cox11 processing, researchers can employ these systematic approaches:

  • Reconcile methodological differences:

    • Compare experimental conditions (strain backgrounds, growth media, extraction methods)

    • Assess whether differences in detection methods might explain discrepancies

    • Consider time points examined, as processing might be dynamic

  • Examine strain-specific variations:

    • Test whether observations are consistent across different strain backgrounds

    • Consider genetic modifiers that might influence processing

  • Investigate regulatory factors:

    • Assess whether growth conditions influence processing

    • Test effects of metabolic state, stress conditions, or cell cycle stage

  • Quantify processing efficiency:

    • Determine relative proportions of processed versus unprocessed forms

    • Analyze kinetics of processing under various conditions

  • Validate key findings with complementary techniques:

    • If contradictions exist between in vitro and in vivo observations, validate with multiple approaches

    • Consider artifacts that might arise from specific experimental methodologies

What bioinformatic tools can help analyze the evolutionary conservation and structural features of Rsm22-Cox11?

Researchers can employ various bioinformatic approaches to analyze Rsm22-Cox11:

  • Sequence conservation analysis:

    • Multiple sequence alignment tools (MUSCLE, Clustal Omega, T-Coffee)

    • Conservation scoring algorithms (ConSurf, Rate4Site)

    • Visualization tools (Jalview, WebLogo)

  • Structural prediction:

    • Secondary structure prediction (PSIPRED, JPred)

    • Transmembrane domain prediction (TMHMM, Phobius)

    • 3D structure prediction (AlphaFold, RoseTTAFold)

  • Functional domain analysis:

    • Conserved domain search (CDD, Pfam, InterPro)

    • Motif identification (MEME, PROSITE)

    • Signal sequence prediction (SignalP, TargetP)

  • Evolutionary analysis:

    • Phylogenetic tree construction (MEGA, PhyML, MrBayes)

    • Selection pressure analysis (PAML, HyPhy)

    • Gene fusion/fission detection (FusedTriplets, MosaicFinder)

  • Processing site prediction:

    • Mitochondrial processing peptidase cleavage site prediction (MitoFates, TPpred)

    • Proteolytic cleavage site prediction (PROSPER, PeptideCutter)

These tools can help researchers understand the evolutionary history of the Rsm22-Cox11 fusion, identify key functional domains, predict processing sites, and assess structural features important for protein function.

What unresolved questions remain about the Rsm22-Cox11 tandem protein?

Despite significant advances in understanding the Rsm22-Cox11 tandem protein, several key questions remain unanswered:

  • Evolutionary origin:

    • When did the gene fusion event occur in the evolutionary history of Schizosaccharomyces?

    • Is this arrangement present in other related fungi?

    • What selective pressures might have favored the maintenance of this fusion?

  • Functional significance:

    • Does the tandem arrangement provide any advantages beyond coordinated expression?

    • Are there conditions under which incomplete processing might occur, resulting in some persistence of the fusion protein?

    • How does processing efficiency respond to various cellular stresses?

  • Regulation:

    • What factors regulate the efficiency of the second processing step?

    • Is there condition-dependent regulation of processing?

    • How is the stoichiometry of Rsm22 and Cox11 maintained after processing?

  • Interaction network:

    • Do the processed Rsm22 and Cox11 domains maintain any physical proximity after separation?

    • How does the processing affect interactions with other mitochondrial proteins?

    • Are there shared chaperones or assembly factors involved in the maturation of both domains?

  • Translational and post-translational regulation:

    • Are there internal ribosome entry sites or alternative translation initiation sites?

    • What post-translational modifications occur on each domain?

    • How is protein quality control managed for the tandem protein?

What emerging technologies could advance research on mitochondrial tandem proteins?

Several cutting-edge technologies hold promise for advancing our understanding of mitochondrial tandem proteins like Rsm22-Cox11:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables high-resolution structural analysis of mitochondrial complexes

    • Could reveal how the tandem protein is organized before processing

    • May identify interaction interfaces between domains

  • Proximity labeling proteomics:

    • Techniques like BioID, APEX, or TurboID can map protein interaction networks

    • Domain-specific labeling could reveal unique interactors for each domain

    • Time-resolved studies could track changes in interactions during processing

  • Single-molecule imaging:

    • Super-resolution microscopy to visualize processing and localization in real-time

    • Single-molecule FRET to assess conformational changes during import and processing

    • Live-cell single-particle tracking to follow the fate of individual molecules

  • CRISPR-based genome engineering:

    • Precise modification of endogenous loci to create reporter fusions

    • Generation of conditional alleles to study essential functions

    • High-throughput screening to identify factors affecting processing

  • Integrative multi-omics approaches:

    • Combining proteomics, transcriptomics, and metabolomics to assess systemic effects

    • Studying correlations between protein processing and metabolic states

    • Identifying regulatory networks controlling tandem protein expression and processing

  • Mitochondrial in organello translation systems:

    • Reconstituted systems to study translation of tandem proteins

    • Assessment of co-translational import and processing

    • Investigation of specialized ribosomes or translation factors

TechnologyApplication to Rsm22-Cox11 ResearchPotential Insights
Cryo-EMStructural analysis of pre-processed complexConformation before processing, interaction interfaces
Proximity labelingDynamic interactome mappingProcessing factors, assembly partners, temporal changes
Super-resolution microscopySubcellular localizationCo-localization of domains, processing sites
CRISPR engineeringIn vivo manipulationEssential regions, regulatory elements, processing dynamics
Ribosome profilingTranslation analysisKinetics, pausing sites, regulatory mechanisms
MetabolomicsFunctional impact assessmentEffects on copper metabolism, respiratory capacity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.