Recombinant Schizosaccharomyces pombe Rsm22-cox11 tandem protein 2, mitochondrial (cos1102)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Schizosaccharomyces pombe Rsm22-cox11 Tandem Protein 2, Mitochondrial (Cos1102)

Recombinant Schizosaccharomyces pombe Rsm22-cox11 tandem protein 2, mitochondrial (Cos1102) is a protein used in life science research . It is produced in E. coli and tagged with His for purification and detection . This protein is related to mitochondrial function and protein transport .

Basic Information

AttributeDescription
Full NameRecombinant Full Length Schizosaccharomyces pombe Rsm22-Cox11 Tandem Protein 2, Mitochondrial (Cos1102) Protein, His-Tagged
Source (Host)E. coli
SpeciesSchizosaccharomyces pombe
TagHis-Tagged
Protein LengthFull Length of Mature Protein (569-753)

Function and Pathways

Cos1102 is involved in several pathways, playing different roles in each . It also has several biochemical functions, some of which it performs alone and others in cooperation with other proteins .

Protein Interactions

Cos1102 directly interacts with other proteins and molecules, as detected through methods such as yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays .

Role of Cox11 in Mitochondrial Function

Cox11 is an integral protein of the mitochondrial inner membrane in eukaryotes . It is essential for the insertion of Cu(I) ions to form the CuB site, which is important for the function of cytochrome c oxidase .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
cox1102; cox11; cox11-b; SPAC19B12.13; SPAPB8E5.01; Rsm22-cox11 tandem protein 2, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
569-753
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
cox1102
Target Protein Sequence
TTIYYLVAISIFALGLTYAAVPLYRLFCSKTGYGGTLNTDQSRMNAERMVPRKDNKRIRV TFNGDVAGNLSWKLWPQQREIYVLPGETALGFYTAENTSDHDIVGVATYNIVPGQAAVYF SKVACFCFEEQKLDAHEKVDLPVFFFIDPEFADDPNMKDIDDILLSYTFFEARYDTNGNL LTKLN
Uniprot No.

Target Background

Function

Rsm22-2 is involved in mitochondrion-encoded protein synthesis. Cox11-2 functions in a late stage of cytochrome c oxidase synthesis, likely by facilitating copper B insertion into subunit I.

Database Links
Protein Families
Methyltransferase superfamily, Rsm22 family; COX11/CtaG family
Subcellular Location
[37S ribosomal protein S22-2]: Mitochondrion matrix.; [Cytochrome c oxidase assembly protein cox11-2]: Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side.

Q&A

What is Rsm22-Cox11 tandem protein 2 and what is its function in S. pombe?

Rsm22-Cox11 tandem protein 2 (Cos1102) is a fusion protein encoded by the cox1102 gene in Schizosaccharomyces pombe. It consists of two functionally distinct domains: Rsm22, which is a component of the mitochondrial ribosome, and Cox11, a factor required for copper insertion into cytochrome oxidase . This tandem organization is relatively unique to S. pombe and represents an interesting case of gene fusion in eukaryotic genomes.

The protein is initially synthesized as a precursor (pre-Rsm22-Cox11) with a mitochondrial targeting sequence. After import into mitochondria, the protein undergoes sequential processing events that ultimately separate the two functional domains . The amino acid sequence of the mature Cox11 domain (residues 569-753) contains regions important for its copper insertion function, including metal-binding motifs essential for its role in cytochrome oxidase assembly .

How does the processing of Rsm22-Cox11 tandem protein occur?

The maturation of Rsm22-Cox11 involves two distinct sequential processing events:

  • Initial processing: The mitochondrial presequence is cleaved upon import into the mitochondria, producing the mature but still fused Rsm22-Cox11 protein.

  • Secondary processing: At a later stage, the Rsm22 and Cox11 domains are separated by cleavage performed by the mitochondrial processing peptidase at an internal processing site .

This sequential processing has been confirmed through in vivo experiments using tagged versions of pre-Rsm22-Cox11, which demonstrated the proteolytic separation of Cox11 from the Rsm22 domain . The biological significance of this two-step processing suggests that the tandem organization might serve to increase import efficiency of Cox11 and/or coordinate expression levels of Rsm22 and Cox11 in S. pombe rather than maintaining a persistent fusion protein .

Why is S. pombe a valuable model organism for studying mitochondrial proteins?

Schizosaccharomyces pombe, commonly known as "fission yeast," is extensively used as a model organism in molecular and cell biology due to several advantageous characteristics:

  • Conserved genomic regions shared with humans, including heterochromatin proteins, large origins of replication, large centromeres, conserved cellular checkpoints, telomere function, and gene splicing mechanisms .

  • Fully sequenced genome (completed in 2002) containing approximately 4,979 genes within three chromosomes and about 14Mb of DNA .

  • Simplified mitochondrial protein import and processing machinery compared to higher eukaryotes, while maintaining core functional conservation.

  • Ease of genetic manipulation and relatively rapid growth cycle, allowing for efficient experimental design and analysis .

These characteristics make S. pombe an excellent model for studying mitochondrial proteins like Rsm22-Cox11, providing insights that can often be extrapolated to more complex eukaryotic systems.

What are the optimal conditions for reconstituting recombinant Rsm22-Cox11 tandem protein?

For optimal reconstitution of lyophilized recombinant Rsm22-Cox11 tandem protein, follow these methodological steps:

  • Centrifuge the vial briefly prior to opening to bring contents to the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (50% is recommended) to stabilize the protein for long-term storage.

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles and store at -20°C/-80°C for long-term stability .

  • For working solutions, store aliquots at 4°C for up to one week, avoiding repeated freeze-thaw cycles which can compromise protein integrity .

The reconstituted protein maintains >90% purity as determined by SDS-PAGE analysis and is suitable for most experimental applications requiring the full-length mature protein (amino acids 569-753) .

How can I design experiments to investigate the functional relationship between Rsm22 and Cox11 domains?

To investigate the functional relationship between Rsm22 and Cox11 domains, consider the following experimental approaches:

  • Domain separation analysis:

    • Create constructs expressing either domain individually

    • Compare cellular localization and function with the tandem protein

    • Assess whether co-expression of separate domains can complement deletion of the tandem gene

  • Temporal analysis of processing:

    • Use pulse-chase experiments with radioactively labeled amino acids

    • Track the appearance of processed forms over time

    • Correlate processing with functional assays for each domain

  • Processing mutant analysis:

    • Introduce mutations at the internal processing site

    • Assess the impact on mitochondrial function, particularly cytochrome oxidase activity

    • Measure copper incorporation in processing-deficient mutants

  • Co-immunoprecipitation studies:

    • Use domain-specific antibodies to determine if processed Rsm22 and Cox11 domains remain physically associated after cleavage

    • Identify other interacting partners for each domain

These approaches can help determine whether the tandem organization serves primarily to coordinate expression, enhance import efficiency, or facilitate functional interactions between the domains after processing .

How can I monitor the sequential processing of pre-Rsm22-Cox11 in real-time?

Monitoring the sequential processing of pre-Rsm22-Cox11 in real-time requires sophisticated experimental design:

  • Fluorescent protein tagging strategy:

    • Generate constructs with different fluorescent proteins fused to each domain (e.g., GFP-Rsm22-mCherry-Cox11)

    • Monitor changes in FRET (Förster Resonance Energy Transfer) signal as processing occurs

    • Correlate changes in fluorescence pattern with mitochondrial import and processing

  • Time-resolved mass spectrometry:

    • Isolate mitochondria at different time points after expressing tagged pre-Rsm22-Cox11

    • Perform mass spectrometry to identify processing intermediates

    • Quantify relative abundance of precursor, intermediate, and fully processed forms

  • In organello import assays:

    • Synthesize radiolabeled pre-Rsm22-Cox11 using in vitro transcription/translation

    • Incubate with isolated mitochondria under conditions that support import

    • Analyze processing kinetics by tracking the appearance of labeled intermediate and mature forms over time

  • Live-cell imaging with domain-specific antibodies:

    • Use cell-permeable fluorescently labeled antibodies specific to each domain

    • Monitor localization and potential co-localization changes during processing

    • Correlate with mitochondrial markers to confirm proper targeting

These methodologies can provide insights into the kinetics and regulation of the sequential processing events, potentially revealing conditions that affect processing efficiency or accuracy .

What experimental approaches can determine if mitochondrial processing peptidase cleavage is regulated?

To investigate the regulation of mitochondrial processing peptidase (MPP) cleavage of Rsm22-Cox11, consider these methodological approaches:

  • Conditional MPP mutants:

    • Generate temperature-sensitive or chemical-inducible mutants of MPP subunits

    • Monitor changes in Rsm22-Cox11 processing under different conditions

    • Assess the specificity of effects by comparing with other MPP substrates

  • Metabolic regulation studies:

    • Grow cells under different metabolic conditions (fermentation vs respiration)

    • Analyze changes in processing efficiency and timing

    • Correlate with cellular energy status and mitochondrial function

  • Stress response analysis:

    • Expose cells to various stressors (oxidative stress, heat shock, nutrient limitation)

    • Determine if processing is altered under stress conditions

    • Identify potential regulatory factors through genetic screens

  • Site-directed mutagenesis of cleavage sites:

    • Introduce systematic mutations around the internal cleavage site

    • Analyze the impact on processing efficiency

    • Identify potential regulatory motifs or secondary structure elements

  • Phosphorylation state analysis:

    • Use phospho-specific antibodies or mass spectrometry to detect phosphorylation near cleavage sites

    • Test if kinase or phosphatase inhibitors affect processing

    • Create phosphomimetic and phospho-null mutants to assess functional significance

These approaches can help determine whether the processing of Rsm22-Cox11 is constitutive or regulated in response to cellular conditions or developmental stages .

What methods are most effective for studying the interactions between Rsm22-Cox11 and other mitochondrial proteins?

To effectively study interactions between Rsm22-Cox11 and other mitochondrial proteins, consider these methodological approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Use His-tagged recombinant Rsm22-Cox11 as bait protein

    • Perform pulldowns from mitochondrial extracts

    • Identify interacting partners through mass spectrometry

    • Validate key interactions with reciprocal pulldowns

  • Proximity-based labeling techniques:

    • Generate BioID or APEX2 fusions with either domain

    • Express in S. pombe and activate labeling

    • Identify proximal proteins through streptavidin pulldown and mass spectrometry

    • Compare interactomes of pre-processed and post-processed forms

  • Yeast two-hybrid screening:

    • Use either full tandem protein or individual domains as bait

    • Screen against a mitochondrial protein library

    • Validate positive interactions through complementary methods

    • Map interaction domains through truncation mutants

  • Co-immunoprecipitation with domain-specific antibodies:

    • Raise antibodies against unique epitopes in Rsm22 and Cox11 domains

    • Perform immunoprecipitation from mitochondrial extracts

    • Identify co-precipitating proteins through western blotting or mass spectrometry

    • Compare interactomes before and after processing

  • Crosslinking mass spectrometry:

    • Apply protein crosslinkers to intact mitochondria

    • Identify crosslinked peptides through specialized mass spectrometry

    • Map interaction interfaces at amino acid resolution

    • Create structural models of protein complexes

These approaches can provide comprehensive insights into the interaction partners of both domains and how these interactions may change after processing .

How can I investigate the copper insertion function of the Cox11 domain after processing?

To investigate the copper insertion function of the Cox11 domain after processing, implement these methodological approaches:

  • Copper-binding assays:

    • Express and purify the processed Cox11 domain

    • Perform atomic absorption spectroscopy to quantify bound copper

    • Compare copper binding between the tandem protein and isolated Cox11 domain

    • Use site-directed mutagenesis to identify critical copper-binding residues

  • Cytochrome oxidase activity assays:

    • Generate Cox11 domain mutants or deletions

    • Measure cytochrome oxidase activity in mitochondrial preparations

    • Correlate activity with copper content and processing state

    • Rescue experiments with exogenous copper supplementation

  • In vitro copper transfer assays:

    • Reconstitute purified Cox11 domain with copper ions

    • Test ability to transfer copper to cytochrome oxidase subunits

    • Use fluorescent copper sensors to monitor transfer kinetics

    • Compare efficiency between processed and unprocessed forms

  • Structural analysis:

    • Determine the 3D structure of the Cox11 domain using X-ray crystallography or cryo-EM

    • Analyze conformational changes upon copper binding

    • Compare structures before and after processing from the Rsm22 domain

    • Identify potential regulatory sites or interaction surfaces

The amino acid sequence of the Cox11 domain (amino acids 569-753) contains conserved motifs typical of copper chaperones, which can be targeted in these functional studies .

How can I address solubility issues when working with recombinant Rsm22-Cox11?

Addressing solubility issues with recombinant Rsm22-Cox11 requires systematic optimization:

  • Buffer optimization:

    • Test various buffer compositions (Tris/PBS-based buffers with different pH values)

    • Add stabilizing agents such as trehalose (6% is recommended in storage buffer)

    • Experiment with ionic strength by varying salt concentrations

    • Include reducing agents to prevent disulfide bond formation

  • Protein concentration management:

    • Maintain protein concentration between 0.1-1.0 mg/mL during reconstitution

    • Determine optimal concentration for specific applications through serial dilutions

    • Consider concentration-dependent aggregation effects

  • Expression system modifications:

    • Compare solubility when expressed in different E. coli strains

    • Test co-expression with molecular chaperones

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider alternative expression hosts if E. coli yields poorly soluble protein

  • Fusion tag strategies:

    • The standard His-tag may be insufficient for optimal solubility

    • Test alternative solubility-enhancing tags (MBP, SUMO, thioredoxin)

    • Position tags at either N- or C-terminus to determine optimal configuration

    • Include TEV or PreScission protease sites for tag removal after purification

  • Domain-based approach:

    • Express Rsm22 and Cox11 domains separately if the tandem protein remains insoluble

    • Reconstitute activity through co-expression or in vitro mixing

    • Map minimal functional domains to eliminate aggregation-prone regions

Implementation of these strategies should be methodical, changing one variable at a time while monitoring solubility through appropriate assays (light scattering, centrifugation testing, size exclusion chromatography).

What experimental controls are essential when studying Rsm22-Cox11 processing?

When studying Rsm22-Cox11 processing, include these essential experimental controls:

  • Domain-specific markers:

    • Generate constructs expressing only Rsm22 or only Cox11 domains

    • Use these as size markers for processed products

    • Include in western blots to confirm antibody specificity

  • Processing enzyme controls:

    • Include MPP-deficient strains or MPP inhibitors

    • Compare processing patterns to wild-type conditions

    • Use known MPP substrates as positive controls

  • Import and processing time course:

    • Collect samples at multiple time points after protein synthesis

    • Track the sequential appearance of processing intermediates

    • Include energy depletion conditions to confirm ATP-dependence of import

  • Subcellular fractionation controls:

    • Include markers for different mitochondrial compartments (matrix, inner membrane, intermembrane space)

    • Verify localization of processing intermediates

    • Use protease protection assays to confirm intramitochondrial location

  • Specificity controls for functional assays:

    • Include enzymatically inactive mutants (e.g., copper-binding site mutants)

    • Test complementation with the orthologous proteins from other species

    • Use specific inhibitors of related pathways to confirm assay specificity

  • Strain background controls:

    • Compare results in different S. pombe strain backgrounds

    • Include wild-type, gene deletion, and complemented strains

    • Assess genetic interactions with related mitochondrial genes

These controls ensure reliable interpretation of experimental results and help distinguish between direct effects on Rsm22-Cox11 processing versus secondary consequences of other cellular perturbations .

How does the tandem organization of Rsm22-Cox11 in S. pombe compare to homologous proteins in other organisms?

The tandem organization of Rsm22-Cox11 in Schizosaccharomyces pombe represents an interesting evolutionary innovation not commonly found in other species:

  • Comparative genomic analysis:

    • In Saccharomyces cerevisiae, Rsm22 and Cox11 are encoded by separate genes, though Cox11 physically associates with the mitochondrial ribosome

    • The tandem arrangement in S. pombe may represent a gene fusion event that occurred after the divergence of these yeast lineages

    • Analysis across other fungal species can reveal when this fusion event likely occurred

  • Functional implications:

    • The physical separation of Cox11 and Rsm22 after processing suggests the tandem arrangement serves regulatory rather than structural purposes

    • Possible functions include:
      a) Coordinated expression of both proteins
      b) Enhanced import efficiency of Cox11
      c) Co-localization during initial mitochondrial targeting

  • Evolutionary advantage assessment:

    • Compare growth rates and cytochrome oxidase assembly efficiency between S. pombe and species with separate genes

    • Introduce the tandem gene into S. cerevisiae to test for functional advantages

    • Create an S. pombe strain with separated genes to test for disadvantages

This comparative approach provides insights into the evolutionary forces driving gene fusion events and their functional consequences in mitochondrial protein biogenesis.

What can structural analysis tell us about the function of Rsm22-Cox11?

Structural analysis of Rsm22-Cox11 can provide significant insights into its function:

  • Domain structure prediction:

    • The Rsm22 domain likely adopts a fold typical of ribosomal proteins

    • The Cox11 domain contains motifs associated with copper binding and transfer

    • The linker region between domains may have specific structural properties related to processing

  • Copper-binding site analysis:

    • The amino acid sequence of Cox11 (569-753) contains conserved motifs typical of copper chaperones

    • Structural analysis can identify the coordination geometry of copper binding

    • Comparison with related copper chaperones can reveal unique features of the S. pombe protein

  • Processing site structural features:

    • Analysis of secondary structure around the internal processing site

    • Identification of potential regulatory elements affecting accessibility to MPP

    • Comparison with other known MPP cleavage sites

  • Experimental structural determination approaches:

    • X-ray crystallography of individual domains or the full tandem protein

    • Cryo-EM analysis to capture processing intermediates

    • NMR studies of dynamic regions, particularly the inter-domain linker

Structural information can guide the design of targeted mutations to test functional hypotheses and provide a framework for understanding the mechanistic details of copper transfer and ribosomal association.

DomainAmino Acid RangePredicted FunctionKey Features
Mitochondrial Targeting Sequence1-??Mitochondrial importPositively charged, amphipathic
Rsm22 Domain??-568Mitochondrial ribosome componentRibosomal protein fold
Linker RegionVariableMPP cleavage siteAccessible to processing peptidase
Cox11 Domain569-753Copper insertion into cytochrome oxidaseCopper-binding motifs

What emerging technologies could advance our understanding of Rsm22-Cox11 function and processing?

Several cutting-edge technologies offer promising approaches for deepening our understanding of Rsm22-Cox11:

  • Cryo-electron tomography:

    • Visualize the native arrangement of Rsm22 and Cox11 within intact mitochondria

    • Capture processing intermediates in their cellular context

    • Map spatial relationships between the protein and its interaction partners

  • Single-molecule tracking:

    • Monitor the movement and processing of individual Rsm22-Cox11 molecules in live cells

    • Correlate mobility changes with processing state

    • Measure residence times in different mitochondrial compartments

  • AlphaFold or RoseTTAFold structural prediction:

    • Generate high-confidence structural models of both domains

    • Predict the structure of the inter-domain linker and processing sites

    • Model conformational changes upon copper binding or protein-protein interactions

  • Ribosome profiling:

    • Analyze translation dynamics of the Rsm22-Cox11 mRNA

    • Identify potential translational pauses that might coordinate domain folding

    • Compare with separated genes in other species

  • CRISPR-based genetic screens:

    • Identify genetic interactors affecting Rsm22-Cox11 processing or function

    • Discover novel components of the copper delivery pathway

    • Uncover regulatory factors controlling expression or processing

  • Integrative multi-omics approaches:

    • Combine proteomics, metabolomics, and transcriptomics data

    • Build comprehensive models of Rsm22-Cox11's role in mitochondrial function

    • Identify condition-specific regulation patterns

These technologies, used in combination, could provide unprecedented insights into the complex biology of this intriguing tandem protein.

How might understanding Rsm22-Cox11 processing contribute to broader mitochondrial research?

Research on Rsm22-Cox11 processing has significant implications for broader mitochondrial biology:

  • Mitochondrial protein import and processing mechanisms:

    • The sequential processing of Rsm22-Cox11 provides a model system for studying the coordination between import and processing machinery

    • Insights could apply to other complex mitochondrial precursor proteins

    • May reveal novel regulatory mechanisms for mitochondrial proteome maintenance

  • Coordination of mitochondrial translation and respiratory complex assembly:

    • The connection between a ribosomal component (Rsm22) and an assembly factor (Cox11) suggests integrated regulation

    • Could inform studies on how mitochondrial translation is coordinated with complex assembly

    • May reveal novel quality control mechanisms

  • Evolution of mitochondrial protein targeting and assembly:

    • The species-specific tandem organization provides insights into evolutionary adaptation of mitochondrial systems

    • Could reveal principles governing the evolution of mitochondrial protein targeting

    • May identify lineage-specific optimizations in mitochondrial function

  • Potential biomedical applications:

    • Mitochondrial disorders often involve defects in protein import, processing, or complex assembly

    • Understanding fundamental mechanisms could inform therapeutic approaches

    • S. pombe models could be used to test interventions before moving to more complex systems

The unique nature of this tandem protein and its processing provides an excellent model system for studying fundamental aspects of mitochondrial biogenesis with potential applications across eukaryotic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.