Recombinant Schizosaccharomyces pombe Sad1-interacting factor 1 (sif1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Sad1-Interacting Factor 1 (Sif1)

Recombinant Schizosaccharomyces pombe Sad1-interacting factor 1 (Sif1) is a protein derived from the fission yeast Schizosaccharomyces pombe . Sif1 is identified as an interacting partner of Sad1, a spindle pole body (SPB) component crucial for spindle formation during cell division . The sad1+ gene, which encodes a protein with a predicted molecular mass of 58 kD, is essential for cell viability, and its deletion results in lethality .

Basic Information of Sif1

Sif1 is a protein that interacts with Sad1 .

  • Gene Names: sif1

  • Other Names: Sad1 interacting factor 1

  • Host: Expressed in Cell Free Expression systems

  • Purity: Typically greater than or equal to 85% as determined by SDS-PAGE

Sad1 Function and Sif1 Interaction

Sad1, a member of the conserved SUN (Sad1-UNC-84) family proteins, plays a critical role in tethering centromeres to the SPB in vegetative cells . It interacts with KASH-family protein Kms1, forming the LINC complex .

Sad1 is essential for spindle formation, as demonstrated by the effects of the sad1.1 mutation on both spindle formation and function . The Sad1 protein, migrating slower than predicted on SDS-PAGE, is exclusively associated with the SPB throughout mitotic and meiotic cycles . Its staining patterns change during SPB differentiation in metaphase II of meiosis, supporting its integral role in SPB function .

Sif1 and Heterochromatin Organization

Recent studies suggest that Sad1 mediates heterochromatin spatial organization . The N-terminal domain of Sad1 (aa 1-169) binds to the H2A-H2B heterodimer, enhancing the phase separation ability of Sad1 and facilitating the recruitment of heterochromatin factors .

Isothermal titration calorimetry (ITC) assays confirm that Sad1 binds H2AB and H2AZB with comparable dissociation constants (KdK_d values of 9.5 μM and 7.5 μM, respectively) . Co-immunoprecipitation (Co-IP) analysis further validates the in vivo interaction between Sad1 and H2A-H2B .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
sif1; SPCC1235.06; Sad1-interacting factor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
sif1
Target Protein Sequence
MSTASEQARLRRERRLNKIKQGGASRINQILGQNSDDSQSDVRATASEEAVHSETATPVT PMSSGFMEKRDDTFNADQVEYLPSQDYHNLESSPFKLQCDSPYNVPPENMFNQNPDFANF FQAMLQSAKEGSDTNFQGENEQIPQATAPLKNLVEKYAHLLAISIVVIVCYFKHLPLLPW TFTVEACLFSIQFVLDRNNGPSYSLLASLASQLPPPYGAMIRHTTSYVPYFTQLITDACM TIFALGLCCYFYPSLVY
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the role of S. pombe as a model organism for studying protein interactions?

Schizosaccharomyces pombe, commonly known as fission yeast, is an established model organism for studying chromosome biological processes. Research employing fission yeast has made important contributions to our understanding of chromosome segregation during meiosis, as well as meiotic recombination and its regulation . S. pombe is particularly valuable for studying protein-protein interactions due to its relatively simple genome, rapid growth rate, and conservation of many fundamental cellular processes with higher eukaryotes. When investigating proteins like Sif1, researchers can leverage these advantages to gain insights into protein function that may be applicable across species.

How do homologous recombination (HR) pathways function in S. pombe?

In S. pombe, homologous recombination serves as a critical DNA repair mechanism, particularly for double-strand breaks (DSBs). The process involves multiple sub-pathways and protein complexes. Central to HR is the Rad51 recombinase, which facilitates strand invasion, aided by mediator proteins that can be categorized into distinct branches. S. pombe contains at least two HR mediator complexes: the Swi5/Sfr1 complex and the Rrp1/Rrp2 complex . These mediators help regulate Rad51 activity and direct repair through specific sub-pathways. Anti-recombinogenic helicases like Srs2 and Fml1 restrict the formation of crossovers by removing Rad51 from single-stranded DNA and channeling repair into synthesis-dependent strand annealing (SDSA) . This intricate regulation ensures the appropriate balance between different HR outcomes.

What techniques are available for studying protein localization in S. pombe?

Several techniques are effective for studying protein localization in S. pombe. For direct visualization, researchers can create fluorophore-tagged fusion proteins using genes encoding red, yellow, and/or cyan fluorophores driven by appropriate promoters. In particular, spore-autonomous promoters like those from eis1 and pil2 genes (or their homologs from other Schizosaccharomyces species) can drive strong fluorescence in spores . For studying proteins involved in DNA damage response, researchers can observe co-localization of fluorophore-tagged proteins with methyl methanesulphonate-induced nuclear foci, as demonstrated with Rrp1 and Rrp2 proteins . This approach provides evidence of complex formation and functional association at sites of DNA damage.

How can researchers distinguish between different HR sub-pathways in S. pombe?

Distinguishing between different HR sub-pathways requires sophisticated genetic and biochemical approaches:

  • Epistasis Analysis: Conducting extensive epistasis analysis between mutants defining different HR proteins (e.g., Rad51, Swi5, Rad57, Rrp1/2) as well as anti-recombinogenic helicases (Srs2, Rqh1) allows researchers to place proteins within specific pathways. For example, studies have demonstrated that Rrp1 and Rrp2 act together with Srs2 and Swi5 independently of Rad57, placing them in the Swi5/Sfr1-dependent HR sub-pathway .

  • Recombination Outcome Assays: Researchers can analyze both the frequency of recombination and the ratio between potential recombination outcomes. A common approach in S. pombe uses HR-dependent restoration of gene activity between tandem repeats containing distinct mutations (e.g., ade6 mutations) . This system can distinguish between gene conversion and deletion-type recombinants, providing insight into which pathways are active.

  • Visualization Systems: Novel visual assays using genes expressing fluorophores from spore-autonomous promoters integrated at specific chromosomal locations can enable immediate assessment of recombination events without requiring tetrad dissection .

What is the functional relationship between different mediator complexes in HR?

The functional relationship between different mediator complexes involves both overlapping and distinct roles:

How can high-throughput methods be implemented to screen for novel factors in meiotic recombination?

Implementing high-throughput screens for novel meiotic factors can be approached through several methodologies:

  • Visual Recombination Assays: Novel visual assays using fluorophores expressed from spore-autonomous promoters allow straightforward assessment of recombination outcomes by epi-fluorescence microscopy. These systems can be integrated into the genome to form genetic intervals at which recombination frequency can be determined .

  • Automated Analysis through Imaging Flow Cytometry: Recombination frequency analysis can be automated using imaging flow cytometry, enabling true high-throughput screens without requiring manual microscopy analysis .

  • Yeast Two-Hybrid Screening: This approach can identify protein-protein interactions, as demonstrated in the identification of interactions between Rrp1, Rrp2, and Swi5 . Researchers can use this method to search for novel interactors of known recombination proteins.

  • Genetic Screens Combined with Visual Reporters: By combining genome-wide deletion or mutation libraries with visual recombination reporters, researchers can rapidly identify genes affecting recombination pathways.

What approaches can be used to resolve contradictory findings in S. pombe recombination studies?

Resolving contradictions in research findings is critical for advancing scientific understanding:

  • Standardizing Experimental Conditions: Many contradictions arise from differences in experimental conditions. Researchers should carefully document growth conditions, strain backgrounds, and specific assay parameters to enable meaningful comparisons between studies .

  • Combining Multiple Assay Systems: Using both genetic plating assays and visual recombination assays can provide complementary data. Visual assays have advantages over traditional methods as they allow immediate assessment without requiring viable progeny .

  • Reconciling Model-Specific Differences: Findings from one model organism may not directly translate to another. When contradictions appear between S. pombe studies and those in other organisms, researchers should consider species-specific pathway variations .

  • Contradiction Detection Methodologies: Advanced computational approaches, including those used in clinical contradiction detection, can be adapted to systematic literature review of S. pombe research. These approaches can identify potentially conflicting claims across multiple publications to guide focused experimental validation .

What are the optimal conditions for expressing recombinant proteins in S. pombe?

Optimal conditions for recombinant protein expression in S. pombe include:

  • Promoter Selection: For constitutive expression, the nmt1 promoter and its attenuated versions (nmt41, nmt81) provide tunable expression levels. For meiosis-specific expression, mei2 or rec8 promoters are effective. For spore-autonomous expression, promoters from eis1 and pil2 genes work well .

  • Species-Specific Promoters: To avoid ectopic recombination with endogenous promoters, researchers can use homologous promoters from related Schizosaccharomyces species. For example, upstream sequences from Sz. japonicus eis1 (SJAG_04227) and pil2 (SJAG_02707), or from Sz. cryophilus and Sz. octosporus pil2 homologues (SPOG_00147 and SOCG_04642) function effectively in Sz. pombe .

  • Integration Site Selection: Careful selection of genomic integration sites can minimize position effects. Common neutral integration sites include leu1 and ura4 loci.

  • Culture Conditions: Standard EMM (Edinburgh Minimal Medium) with appropriate supplements based on auxotrophic markers is typically used. For induction of meiosis, nitrogen starvation in EMM-N or growth on malt extract medium is effective.

What tagging strategies minimize interference with protein function?

To minimize interference with protein function when tagging:

How can researchers quantitatively measure recombination frequencies and outcomes?

Quantitative measurement of recombination can be approached through several methods:

  • Genetic Plating Assays: The traditional approach involves using strains with genetic markers flanking the region of interest. After meiosis, spores are germinated and grown on selective media to identify recombinant progeny .

  • Visual Recombination Assays: By integrating fluorophore-expressing constructs into the genome at specific loci, researchers can visualize recombination outcomes directly in tetrads using fluorescence microscopy . This approach allows immediate assessment without requiring tetrad dissection.

  • Automated Analysis: Imaging flow cytometry can be used to automatically quantify fluorescence patterns in large numbers of asci, enabling high-throughput analysis of recombination outcomes .

  • Direct Molecular Analysis: Southern blotting can detect recombination intermediates, though this approach is more laborious and not suitable for high-throughput screens .

The table below compares these different methodologies:

MethodThroughputAdvantagesLimitations
Genetic PlatingMediumWell-established, quantitativeRequires viable progeny, labor-intensive
Visual Assay (Microscopy)MediumImmediate results, no dissection neededRequires fluorescence microscope
Imaging Flow CytometryHighAutomated, high-throughputSpecialized equipment needed
Southern BlottingLowDetects intermediates, high specificityLabor-intensive, low throughput

What are promising approaches for elucidating the structural basis of S. pombe recombination protein interactions?

Promising structural biology approaches include:

  • Cryo-Electron Microscopy: Recent advances in cryo-EM allow visualization of protein complexes at near-atomic resolution without requiring crystallization. This approach is particularly valuable for studying dynamic complexes like those involved in HR.

  • Integrative Structural Biology: Combining multiple techniques (X-ray crystallography, NMR, SAXS, cross-linking mass spectrometry) provides complementary structural information.

  • AlphaFold and Computational Approaches: AI-based structure prediction combined with molecular dynamics simulations can provide insights into protein-protein interactions, especially when experimental structures are challenging to obtain.

  • In-cell NMR: This emerging technique allows studying protein structures in their natural cellular environment, providing insights into how cellular conditions affect complex formation.

How might emerging genome editing technologies advance S. pombe recombination research?

Emerging genome editing technologies offer new possibilities:

  • CRISPR-Cas9 Applications: CRISPR technology adapted for S. pombe enables precise genome editing, including the creation of point mutations to study specific domains within recombination proteins. This approach facilitates structure-function studies without the need for overexpression.

  • Base Editing and Prime Editing: These refined CRISPR technologies allow for precise nucleotide changes without double-strand breaks, enabling subtle modifications to study specific protein residues.

  • Inducible Degron Systems: Auxin-inducible degron (AID) and other rapid protein depletion systems adapted for S. pombe allow temporal control of protein degradation, facilitating studies of protein function at specific cell cycle stages.

  • Genomic DNA Curtains: This single-molecule approach allows direct visualization of protein-DNA interactions in real-time, offering insights into the dynamics of recombination processes that are difficult to capture with traditional biochemical approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.