Recombinant Schizosaccharomyces pombe Seipin homolog (SPAC3A11.04)

Shipped with Ice Packs
In Stock

Description

General Information

The Schizosaccharomyces pombe Seipin homolog, also known as SPAC3A11.04, is a protein involved in lipid metabolism and lipid droplet (LD) morphology, number, and size . It facilitates the initiation of LD formation and ensures vectorial budding .

Role in Lipid Droplet Formation

Seipin homologs play a crucial role in the formation and maintenance of lipid droplets within cells . Lipid droplets are cellular organelles responsible for storing neutral lipids, such as triglycerides and sterol esters . SPAC3A11.04, as a Seipin homolog, is vital for the proper development and function of these lipid droplets in Schizosaccharomyces pombe .

Involvement in Cellular Processes

  • Autophagy: S. pombe DJ-1 homologs are implicated in autophagy, a cellular process that removes dysfunctional components .

  • Oxidative Stress Resistance: Sdj1, a DJ-1 homolog in S. pombe, is involved in protecting the cell against oxidative stress .

  • Iron Homeostasis: Grx4, Fep1, and Php4 in S. pombe play cooperative roles in maintaining iron homeostasis .

  • Mitochondrial Function: Shy1, another protein in S. pombe, is essential for the regular function of mitochondria by participating in the assembly of complex IV .

Research and Study

Scientific investigations often explore the functions and interactions of proteins like SPAC3A11.04 to understand their roles in cellular mechanisms . Techniques such as bioinformatics analysis, gene expression studies, and protein-protein interaction analysis are employed to elucidate these functions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAC3A11.04; Seipin homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC3A11.04
Target Protein Sequence
MGYLVKLFKLVVWMLVIGLFSIPSLVSYVIFYDTVIPHSVIQYPVYFNYTTGLNFPTAEV RLDHFSIDPRLPGTSLLQIKMPHSPRNSAMGNFMVSVDFQDRNQRSLKQVKRTVLLPHRS PIHEYLKLIVCSPLYFMGILEETDIVNVRLFESETFAKSFNSITTLSVRFSVKNTPAQAI VKIYSKDIEFYEATLAFASKLHGMRWFMYTHKVSAFLVFTSLFWFTGITSTIITYLIVSS TSETKATRR
Uniprot No.

Target Background

Function

This protein is involved in lipid metabolism and influences the morphology, number, and size of lipid droplets (LDs). It facilitates the initiation of LD formation and ensures that LD budding from the endoplasmic reticulum (ER) is directed towards the cytoplasm.

Database Links
Protein Families
Seipin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Schizosaccharomyces pombe Seipin homolog (SPAC3A11.04)?

The Schizosaccharomyces pombe Seipin homolog (SPAC3A11.04) is a membrane protein involved in lipid droplet (LD) biogenesis at the endoplasmic reticulum (ER). This protein, encoded by the gene with Uniprot identifier O14119, is part of a conserved family of proteins essential for proper LD formation and is functionally related to human Seipin, mutations in which cause lipodystrophy . The protein's functional characteristics include:

  • Forms oligomeric rings at ER sites where LDs form

  • In S. pombe, functions in complex with Ldb16 protein

  • Contains a luminal domain with a distinct structural organization compared to its human counterpart

  • Plays a critical role in orchestrating the process of neutral lipid packaging into LDs

How does S. pombe Seipin homolog differ from human Seipin?

Several key differences distinguish S. pombe Seipin homolog from its human counterpart:

FeatureS. pombe Seipin homologHuman Seipin
FunctionalityRequires binding partner Ldb16Functions independently
Luminal domainTwo short orthogonal hydrophilic helices (α1 and α2)Single membrane-protruding hydrophobic helix
TAG concentrationCannot concentrate triacylglycerol within its ring aloneHydrophobic helix directly concentrates TAG
Ring structureHomodecameric arrangementHomo-oligomeric ring of 11 subunits
Lipid bindingRelies on Ldb16 for TAG bindingDirectly binds TAG via serine residues

Unlike human Seipin, the S. pombe homolog cannot function alone but requires its partner Ldb16. Interestingly, human Seipin can restore normal LD formation in yeast mutants lacking both Sei1 and Ldb16, suggesting that in yeast, Seipin function is distributed between two proteins .

How can one effectively express and purify recombinant S. pombe Seipin homolog for structural studies?

Expression and purification of Seipin homolog requires specific approaches due to its transmembrane nature:

  • Expression system selection:

    • Utilize yeast expression systems (preferably S. cerevisiae) for proper post-translational modifications

    • Alternative systems include insect cells (Sf9) for higher yields

  • Fusion tag optimization:

    • C-terminal tagging with 3xFLAG or streptavidin binding protein (SBP) has been successfully employed

    • N-terminal tagging may interfere with proper membrane insertion

  • Purification protocol:

    • Solubilize membranes using mild detergents (LMNG, DDM, or GDN)

    • Implement sequential affinity chromatography followed by size exclusion

    • Maintain 50% glycerol in Tris-based buffer for storage stability

  • Cryo-EM sample preparation challenges:

    • Sample vitrification often leads to loss of binding partners (like Ldb16)

    • Consider GraFix technique or mild crosslinking to stabilize protein complexes

    • Reconstitute in nanodiscs or amphipols for structural integrity

What experimental approaches can be used to study Seipin homolog's role in lipid droplet formation?

Several complementary approaches have yielded significant insights:

  • Cryo-electron microscopy (cryo-EM):

    • Reveals oligomeric ring assembly and structural details of the luminal domain

    • Enables visualization of interactions with membrane and binding partners

  • Molecular dynamics (MD) simulations:

    • Coarse-grained simulations reveal TAG accumulation patterns

    • Demonstrate differences in lipid-concentrating abilities between yeast and human Seipin

    • Identify key amino acids involved in TAG interactions

  • Photo-crosslinking approaches:

    • Used to map protein-protein interactions within the Seipin complex

    • Reveal spatial arrangement of Ldb16 and other accessory proteins

    • Demonstrate complex assembly in the absence of neutral lipids

  • Lipid droplet induction assays:

    • Controlled expression of lipid biosynthetic enzymes (Dga1, Lro1, Are1)

    • Allow temporal tracking of complex assembly during LD formation

    • Reveal dynamic rearrangements of complex components

How can one analyze lipid binding properties of the Seipin homolog complex?

Analysis of lipid binding properties requires specialized techniques:

  • In vitro lipid binding assays:

    • Fluorescence-based assays with labeled lipids

    • Surface plasmon resonance with immobilized protein

    • Isothermal titration calorimetry for binding kinetics

  • Specialized microscopy approaches:

    • FRET-based imaging to detect protein-lipid interactions

    • Super-resolution microscopy to visualize LD formation sites

    • Time-lapse imaging to track dynamics of complex assembly

  • Site-directed mutagenesis strategy:

    • Target hydroxyl-containing residues in Ldb16 (similar to serine residues in human Seipin)

    • Focus on transmembrane segments of Sei1 that contribute to TAG recruitment

    • Evaluate the "locking helix" structural element for its role in Ldb16 stability

What is known about the interactome of S. pombe Seipin homolog?

The S. pombe Seipin homolog functions within a complex network of protein interactions:

  • Core complex components:

    • Sei1: Forms the scaffolding oligomeric ring

    • Ldb16: Primary TAG-binding partner, positioned by Sei1

  • Accessory factors (identified through proximity labeling):

    • Ldo45: Acts as a central hub recruiting other factors to the Seipin complex

    • Ldo16: Interacts with distinct regions of Ldb16

    • Tgl4: Localizes at the ER-LD contact site

    • Pln1: Found at the LD surface

These interactions are dynamic and undergo rearrangements during LD formation. Importantly, overexpression of any accessory factor causes LD aggregation, highlighting the importance of their stoichiometry within the complex .

How do mutations in Seipin homolog affect lipid droplet morphology?

Mutations in Seipin homolog lead to specific phenotypes that provide insights into its function:

Mutation TypeObserved PhenotypeMechanistic Insight
Complete deletion (sei1Δ)Aberrant LD morphology with clustered small LDs and super-sized LDsDefective LD biogenesis and maturation
Transmembrane segment mutationsDecreased Ldb16 stability and reduced TAG recruitmentTM segments critical for initial TAG concentration
Luminal domain mutationsImpaired Ldb16 positioningLuminal domain acts as scaffold for partner proteins
Partner mutations (ldb16Δ)Identical phenotype to sei1ΔFunctional co-dependence of complex components
Combined accessory factor mutationsAdditive effects on LD morphologyPartial functional redundancy among accessory factors

Research indicates that single mutations in accessory factors produce minor LD morphology changes, while combined mutations have more significant effects, suggesting functional interactions among these proteins .

What is the relationship between Seipin homolog and mitochondrial function in S. pombe?

While primarily involved in LD formation, evidence suggests connections between Seipin function and mitochondrial processes:

  • Iron metabolism connection:

    • Disruption of mitochondrial proteases (like Lon1) affects iron homeostasis

    • Iron dysregulation affects various cellular processes including lipid metabolism

  • Stress response interplay:

    • Mitochondrial dysfunction triggers stress responses that may affect Seipin function

    • Genes ameliorating stress and iron assimilation show altered expression in protease-deficient cells

  • Cellular adaptation mechanisms:

    • Cells with compromised mitochondrial function show transcriptional signatures resembling iron insufficiency

    • These adaptive responses may influence lipid storage and LD formation

What are the optimal genetic manipulation approaches for studying Seipin homolog in S. pombe?

S. pombe offers several genetic tools for studying Seipin function:

  • Gene deletion strategies:

    • Standard PCR-based homologous recombination for single gene deletions

    • CRISPR-based gene editing for multiple gene deletions using S. pyogenes Cas9

  • Protein tagging approaches:

    • C-terminal tagging preserves function (3xFLAG, GFP)

    • Expression from native promoter (494 bp upstream of SEI1 ORF) maintains physiological levels

    • Galactose-inducible promoters allow controlled overexpression

  • Plasmid-based expression systems:

    • pRS series vectors (pRS316, pRS415, pRS416, pRS425) for complementation studies

    • ADH1 promoter for constitutive expression

    • Terminator selection impacts expression levels and stability

  • Strain selection considerations:

    • Wild-type reference: Strain 972 (ATCC 24843)

    • Haploid strains simplify phenotypic analysis

    • Ability to switch between haploid and diploid states provides experimental flexibility

What are common challenges in working with recombinant S. pombe Seipin homolog and how can they be addressed?

Researchers face several challenges when working with this protein:

  • Protein instability issues:

    • Store at -20°C in 50% glycerol for extended storage

    • Avoid repeated freeze-thaw cycles

    • Prepare working aliquots for storage at 4°C for up to one week

  • Complex reconstitution difficulties:

    • Co-express Sei1 and Ldb16 to maintain complex integrity

    • Sample vitrification can cause loss of binding partners

    • Consider mild crosslinking to stabilize protein-protein interactions

  • Expression troubleshooting:

    • Optimize codon usage for expression system

    • Consider fusion tags that enhance solubility

    • Monitor protein degradation with appropriate protease inhibitors

  • Functional assay limitations:

    • LD visualization requires specialized staining (BODIPY, Nile Red)

    • Quantitative assessment of LD size/distribution needs image analysis tools

    • Biochemical assays must account for membrane-associated nature of the protein

How can researchers effectively visualize and quantify lipid droplets in S. pombe?

Visualization and quantification of LDs require specialized techniques:

  • Fluorescence microscopy approaches:

    • Lipophilic dyes: BODIPY 493/503 or Nile Red for LD staining

    • GFP-tagged LD proteins (e.g., Pln1-GFP) for live-cell imaging

    • Super-resolution microscopy for detailed LD morphology analysis

  • Electron microscopy methods:

    • Transmission electron microscopy with osmium tetroxide staining

    • Correlative light and electron microscopy for targeted analysis

    • Cryo-electron tomography for 3D reconstruction of LD architecture

  • Quantitative analysis workflow:

    • Automated image analysis using ImageJ/Fiji with specialized plugins

    • Machine learning approaches for unbiased LD classification

    • Statistical analysis to account for cell-to-cell variability

  • Time-lapse imaging considerations:

    • Photobleaching minimization strategies

    • Temperature-controlled chambers for physiological conditions

    • Careful selection of time intervals to capture dynamic processes

How can insights from S. pombe Seipin homolog research be translated to understanding human lipid storage disorders?

S. pombe Seipin research provides valuable insights applicable to human disease:

  • Comparative structural analysis:

    • Despite structural differences, S. pombe and human Seipin share core functional principles

    • The distributed functionality in yeast (Sei1/Ldb16) vs. unified in humans offers mechanistic insights

    • TAG concentration mechanisms through hydroxyl-containing residues are conserved

  • Disease-relevant mutational analysis:

    • Human lipodystrophy-causing mutations can be modeled in conserved regions

    • Functional complementation studies (human Seipin in yeast) reveal essential activities

    • Separation of function mutations distinguish between different Seipin roles

  • Therapeutic target identification:

    • Accessory factors like Ldo45/Ldo16 have human homologs (PROMETHIN/LDAF1)

    • Understanding complex stoichiometry may inform therapeutic approaches

    • LD formation steps represent potential intervention points

What novel methodologies are emerging for studying the dynamics of Seipin complex assembly?

Cutting-edge approaches are advancing our understanding of Seipin dynamics:

  • Advanced imaging techniques:

    • Single-molecule tracking to follow individual complex components

    • Lattice light-sheet microscopy for reduced phototoxicity in long-term imaging

    • Super-resolution microscopy (PALM/STORM) for precise localization

  • Proximity labeling approaches:

    • TurboID-based systems for rapid biotin labeling of neighboring proteins

    • Spatial-specific protein identification during different phases of LD formation

    • Temporal mapping of protein interactions during stress conditions

  • In vitro reconstitution systems:

    • Synthetic membrane systems with purified components

    • Microfluidic approaches for controlled lipid addition

    • Direct visualization of LD budding from artificial membranes

  • Integrative structural biology:

    • Combining cryo-EM, crosslinking mass spectrometry, and MD simulations

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Integrative modeling to place accessory factors within the complete complex

What are the future research directions for understanding Seipin homolog function in cellular lipid homeostasis?

Several promising research directions merit further investigation:

  • Systems biology approaches:

    • Global lipidomic analysis following Seipin manipulation

    • Transcriptomic profiling to identify regulatory networks

    • Metabolic flux analysis to determine impact on cellular energy homeostasis

  • Stress response connections:

    • Relationship between LD formation and cellular stress responses

    • Role of Seipin in adaptive responses to nutrient limitation

    • Connections to mitochondrial function and iron metabolism

  • Evolutionary conservation analysis:

    • Comparative studies across diverse fungal species

    • Mapping functional domains through evolutionary constraints

    • Understanding why some organisms require Ldb16-like partners while others don't

  • Integration with other cellular processes:

    • Connection to cell cycle regulation (like Cds1Chk2 phosphorylation seen with Rad60)

    • Relationship with cytoskeletal elements (similar to Pxl1's role in cytokinesis)

    • Potential roles in membrane trafficking and organelle contacts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.