Recombinant Schizosaccharomyces pombe Seven transmembrane protein 1 (stm1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them when placing your order, and we will prepare it according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
For your information, all our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
We advise against repeated freezing and thawing. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
stm1; SPAC17C9.10; Seven transmembrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
stm1
Target Protein Sequence
MSVIAPSFDMANILTELSSFLGALSLGCWVVLLIPQLLENYKNQSGESISDLFLIIWLIG DFFNVLGSIYGNVSSTVLVLSFYYIVSDSTLLMQIYYYRWKAARRIASREHEPLLQSRSL EEGLHAPIGKQQIWWDRLSTRQQFGVMGCVVIVSTIVGNLIISSASSDKSDDDLNAWPFT AGCISSVLYFCARIPQIIKNHKAKSTEGLSIIFFVLASVGNTSYAFSILVFPASDYLNYT YANLPWILGAFSTIFLDIYIFYQFIKYRNHY
Uniprot No.

Target Background

Database Links
Protein Families
Laat-1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Stm1 protein?

Stm1 is a G-protein-coupled receptor (GPCR) characterized by seven transmembrane spanning regions in the fission yeast Schizosaccharomyces pombe. As with other GPCRs, the protein features an extracellular N-terminus, seven membrane-spanning α-helical domains connected by alternating intracellular and extracellular loops, and an intracellular C-terminus. This structural arrangement is critical for its signaling function, as it enables the protein to transduce extracellular signals across the cell membrane to activate intracellular G-protein-mediated pathways. The protein's structural features must be preserved during recombinant expression to maintain functionality, which presents specific challenges for researchers working with this receptor.

What are the primary functions of Stm1 in S. pombe?

Stm1 functions primarily as a signaling receptor in S. pombe, involved in nutrient sensing and stress response pathways. The protein interacts with G-proteins to activate downstream signaling cascades in response to environmental stimuli. Understanding these functions requires careful experimental design to maintain the native conformation and activity of the protein. When investigating Stm1 function, researchers should consider using physiologically relevant conditions that mimic the natural cellular environment. Functional assays typically involve measuring G-protein activation, downstream effector responses, or ligand binding capabilities to assess whether recombinant Stm1 retains its native activity profile.

What are the recommended expression systems for recombinant Stm1 production?

Homologous expression in S. pombe has proven successful for functional Stm1 production. The most effective documented approach involves cloning the entire coding sequence (without the termination codon) followed by a C-terminal His6 tag into the pREP1 vector . This system utilizes the nmt1 (no message in thiamine) promoter, which provides stringent control of expression levels. The homologous expression approach offers significant advantages for maintaining proper protein folding and post-translational modifications compared to heterologous systems. When selecting an expression system, researchers should prioritize maintaining the native conformation of this seven-transmembrane protein, as improper folding commonly occurs in heterologous hosts for membrane proteins.

How can expression levels of recombinant Stm1 be optimized?

Expression optimization for Stm1 requires careful consideration of induction conditions, particularly when using the nmt1 promoter system. Studies have shown that proper induction can yield expression levels approximately 120 times higher than uninduced controls, producing approximately 500 ng protein per 2 × 10^7 cells . Optimization parameters include:

ParameterRecommendationRationale
Induction time16-24 hoursAllows sufficient time for protein accumulation without excessive stress to cells
Culture densityMid-log phase (OD600 0.5-0.8)Balances cell number with metabolic activity
Thiamine concentrationComplete removalFor full nmt1 promoter derepression
Temperature30°COptimal for S. pombe growth while maintaining protein stability
Media compositionMinimal media with appropriate supplementsReduces background protein expression

Researchers should systematically optimize these parameters for their specific experimental setup, as strain variations and vector modifications may affect expression outcomes.

What challenges are associated with expressing membrane proteins like Stm1?

The expression of seven-transmembrane proteins like Stm1 presents several challenges including proper membrane insertion, correct folding, and maintaining functionality. Membrane proteins often form aggregates or inclusion bodies when overexpressed, particularly in heterologous systems. The homologous expression approach in S. pombe helps mitigate these issues by providing the native cellular machinery for proper membrane insertion and folding . Researchers should monitor protein localization using techniques such as fluorescence microscopy with tagged constructs to confirm proper membrane integration. Additionally, detergent screening is critical during solubilization and purification steps to maintain the native conformation of the protein.

How should experiments be designed to study Stm1 functionality?

Designing experiments to study Stm1 functionality requires careful consideration of experimental variables and controls. The experimental design should include appropriate positive and negative controls, replication for statistical validity, and systematic variation of independent variables . For Stm1 specifically, functionality can be assessed through:

  • G-protein activation assays measuring GTP binding or hydrolysis

  • Ligand binding studies using labeled potential ligands

  • Downstream signaling pathway activation measurements

  • Phenotypic rescue experiments in Stm1-deficient strains

All experimental designs should incorporate proper randomization to control for extraneous variables that might confound results, ensuring that observed effects can be attributed to the manipulated variables rather than uncontrolled factors .

What controls are essential for Stm1 expression and purification experiments?

Essential controls for Stm1 expression and purification experiments include:

  • Empty vector control: Cells transformed with expression vector lacking the Stm1 gene

  • Uninduced control: Cells containing the Stm1 construct but grown under repressive conditions (with thiamine for nmt1 promoter)

  • Wild-type Stm1 without tags: To assess the effect of affinity tags on protein function

  • Denatured protein control: For protein activity assays to establish baseline

  • Subcellular fractionation controls: To verify membrane localization

These controls help researchers distinguish between specific effects related to Stm1 expression and non-specific effects related to the expression system or purification process. Properly controlled experiments are fundamental to establishing valid cause-and-effect relationships in Stm1 research .

How can researchers validate that recombinant Stm1 maintains its native conformation?

Validating the native conformation of recombinant Stm1 requires multiple complementary approaches:

  • Functional assays: Testing G-protein coupling and signal transduction capabilities

  • Circular dichroism (CD) spectroscopy: To assess secondary structure composition

  • Limited proteolysis: Comparing digestion patterns of native and recombinant protein

  • Ligand binding assays: Measuring affinity for known ligands

  • Thermal stability assays: Evaluating protein stability under different conditions

These validation methods provide multidimensional evidence of proper protein folding and function. Researchers should implement at least two independent validation approaches to confidently establish that their recombinant Stm1 preparation maintains native conformation before proceeding with further functional studies.

How does the signaling mechanism of Stm1 compare to other GPCRs?

Stm1, as a seven-transmembrane GPCR in S. pombe, exhibits both similarities and differences compared to mammalian GPCRs. While the general mechanism of G-protein activation is conserved, differences may exist in ligand binding specificity, coupling preferences, and regulatory mechanisms. Comparative studies require careful experimental design with appropriate controls for each receptor system . Researchers investigating Stm1 signaling should consider:

  • G-protein subtype selectivity assays

  • Biased signaling analysis (G-protein vs. arrestin pathways)

  • Receptor internalization and recycling dynamics

  • Cross-talk with other signaling pathways

These advanced investigations require sophisticated experimental approaches, including FRET/BRET-based interaction assays, phosphorylation-specific antibodies, and genetic manipulation of downstream components.

What methodologies are most effective for studying Stm1-protein interactions?

Studying Stm1-protein interactions requires specialized methodologies suitable for membrane proteins. Effective approaches include:

MethodologyApplicationAdvantagesLimitations
Co-immunoprecipitationIdentifying stable interacting partnersWorks with native complexesMay miss weak or transient interactions
Proximity labeling (BioID, APEX)Mapping protein neighborhoodCaptures transient interactionsRequires genetic modification
Surface plasmon resonanceMeasuring binding kineticsProvides real-time binding dataRequires purified proteins
Yeast two-hybrid variantsScreening for interactorsHigh-throughput capabilityPotential false positives
Crosslinking mass spectrometryIdentifying interaction interfacesProvides structural informationComplex data analysis

The choice of methodology should align with the specific research question, considering factors such as the nature of the interaction (stable vs. transient), the cellular context, and the required level of detail .

How can researchers address challenges in structural characterization of Stm1?

Structural characterization of seven-transmembrane proteins like Stm1 presents significant challenges due to their membrane-embedded nature. Researchers can approach this problem through:

  • Cryo-electron microscopy: Particularly useful for membrane proteins that resist crystallization

  • X-ray crystallography with lipidic cubic phase: Specialized approach for membrane protein crystallization

  • NMR spectroscopy with detergent-solubilized protein: Provides dynamic structural information

  • Molecular modeling and simulation: Complements experimental approaches

Each method requires specific sample preparation techniques and has distinct advantages and limitations. Structural studies typically require milligram quantities of highly pure, homogeneous protein, necessitating optimization of expression and purification protocols beyond what might be needed for functional studies . Researchers may need to engineer stability-enhancing mutations or utilize fusion partners to facilitate structural determination.

What purification strategy yields the highest purity and functionality for Stm1?

Purification of functional Stm1 requires careful consideration of detergent selection and purification conditions to maintain native conformation. A recommended purification workflow includes:

  • Membrane fraction isolation from S. pombe cells expressing Stm1-His6

  • Detergent screening for optimal solubilization (typically mild non-ionic detergents like DDM or LMNG)

  • Immobilized metal affinity chromatography (IMAC) using the His6 tag

  • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

  • Functional validation at each purification step

This approach typically yields protein of >90% purity with preserved functionality. Critical parameters to monitor include detergent concentration, buffer pH and ionic strength, and exposure time to each purification condition. Researchers should implement quality control checks after each purification step, including SDS-PAGE, Western blotting, and activity assays to ensure that functionality is maintained throughout the purification process.

How can researchers accurately quantify Stm1 expression levels?

Accurate quantification of Stm1 expression requires methods suitable for membrane proteins. Recommended approaches include:

  • Western blot analysis with calibrated standards: Provides specific quantification when antibodies are available

  • Fluorescence-based quantification: For GFP-tagged constructs, allowing in vivo monitoring

  • Radioligand binding assays: Quantifies functional receptor concentration

  • His-tag-based quantification: For tagged constructs using commercial kits

The expression after induction using the nmt1 promoter system has been reported to be approximately 120 times higher than uninduced controls, yielding approximately 500 ng protein per 2 × 10^7 cells . Researchers should employ at least two independent quantification methods to cross-validate results, as each method has specific limitations and potential biases.

What cell fractionation methods are most effective for isolating membrane-bound Stm1?

Effective isolation of membrane-bound Stm1 requires specialized fractionation techniques that preserve protein-membrane associations. A recommended protocol includes:

  • Mechanical cell disruption (e.g., glass bead lysis) in buffer containing protease inhibitors

  • Low-speed centrifugation to remove unbroken cells and debris (1,000-3,000 × g)

  • Ultracentrifugation to pellet membrane fractions (100,000 × g for 1 hour)

  • Membrane washing to remove peripherally associated proteins

  • Selective solubilization of different membrane fractions using detergent gradients

This fractionation approach allows for enrichment of Stm1-containing membranes while minimizing contamination with other cellular components. Researchers should verify the purity of membrane fractions using markers for different cellular compartments (plasma membrane, ER, Golgi) through Western blotting or enzymatic activity assays.

How should researchers analyze data from Stm1 functional assays?

Data analysis for Stm1 functional assays should follow rigorous statistical approaches appropriate for experimental design. Key considerations include:

  • Statistical test selection based on data distribution and experimental design

  • Multiple comparison corrections for experiments testing several conditions

  • Dose-response curve fitting for ligand binding or activation studies

  • Time-course analysis for signaling dynamics experiments

All data should be analyzed using appropriate statistical methods to determine significance levels, with clear reporting of sample sizes, replication, and statistical tests used . Researchers should consider potential sources of variability in Stm1 assays, including batch-to-batch variation in protein preparation, cell passage number effects, and environmental factors that might influence signaling pathways.

What approaches can resolve contradictory findings in Stm1 research?

Resolving contradictory findings in Stm1 research requires systematic analysis of methodological differences and careful experimental design. Approaches include:

  • Direct replication studies following the original protocols precisely

  • Systematic variation of experimental conditions to identify critical parameters

  • Side-by-side comparison of different methods using the same biological samples

  • Meta-analysis of published data to identify patterns across studies

  • Collaborative cross-laboratory validation studies

When analyzing contradictions, researchers should consider differences in expression systems, purification methods, assay conditions, and data analysis approaches that might explain discrepancies . The resolution process should be approached methodically, testing one variable at a time while maintaining rigorous controls.

How can researchers determine if Stm1 modifications affect protein function?

Determining the impact of modifications (mutations, tags, fusion partners) on Stm1 function requires comparative analysis with unmodified protein. A comprehensive assessment includes:

  • Comparative activity assays measuring key functional parameters

  • Localization studies to confirm proper membrane insertion

  • Stability assessments under various conditions

  • Interaction analyses with known binding partners

  • In vivo complementation assays in Stm1-deficient strains

Results should be analyzed to determine both statistical and biological significance of any observed differences. Researchers should be particularly cautious when interpreting results from modified Stm1 constructs, especially when modifications are introduced near functional domains or transmembrane segments that might affect protein conformation or ligand binding.

What strategies can address low expression levels of recombinant Stm1?

Low expression of recombinant Stm1 is a common challenge that can be addressed through several strategies:

IssuePotential SolutionImplementation
Weak promoter activityOptimize induction conditionsTest different induction times and conditions for nmt1 promoter
Protein toxicityUse tightly regulated expressionImplement tetracycline-inducible or similar systems
mRNA stability issuesCodon optimizationAdjust codon usage to match host preferences
Protein degradationAdd protease inhibitorsInclude complete protease inhibitor cocktail during extraction
Poor translationOptimize Kozak sequenceModify nucleotides surrounding the start codon

For the nmt1 promoter system specifically, researchers should verify complete thiamine removal from media and optimize induction timing to maximize expression while minimizing stress responses that might lead to protein degradation .

How can researchers overcome protein aggregation during Stm1 purification?

Protein aggregation during Stm1 purification can be addressed through:

  • Detergent screening: Test multiple detergents and concentrations to identify optimal solubilization conditions

  • Buffer optimization: Adjust pH, ionic strength, and glycerol content to enhance stability

  • Temperature control: Maintain samples at 4°C throughout purification

  • Addition of stabilizing agents: Consider adding specific lipids, cholesterol, or small molecule stabilizers

  • Engineered constructs: Consider thermostabilizing mutations or fusion partners for problematic constructs

Researchers should monitor aggregation using analytical techniques such as dynamic light scattering or size exclusion chromatography throughout the purification process. Early detection of aggregation allows for immediate intervention and protocol adjustment before proceeding to subsequent purification steps.

What approaches can verify the functionality of purified Stm1?

Verifying functionality of purified Stm1 requires multiple complementary assays:

  • Ligand binding assays: Using known or putative ligands

  • G-protein coupling assays: Measuring nucleotide exchange or GTPase activity

  • Conformational analysis: Using intrinsic fluorescence or circular dichroism

  • Reconstitution experiments: Incorporating purified protein into liposomes or nanodiscs for functional studies

  • Thermal stability assays: Assessing protein stability with and without ligands

These functional verification steps are essential before proceeding with advanced structural or interaction studies. Researchers should establish clear acceptance criteria for functional assays based on comparison with native protein or previously characterized recombinant preparations. Documentation of functionality using multiple independent assays strengthens confidence in subsequent experimental findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.