Recombinant Schizosaccharomyces pombe Signal peptidase complex subunit spc2 (spc2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
spc2; SPAC1071.04c; Signal peptidase complex subunit spc2; Microsomal signal peptidase subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
spc2
Target Protein Sequence
MPKYNVSDFKSKFDKELTNHFNKNGYKQSFVFEDIRLLIAIACIIPAGLAFGIEYVYGFG VLKSYLKYLLPLYFLASCLLTFWSSVVKGSTVYVATKKERHIKISADTFLPLKNKPLITT KFTVLKNRNAVQLEWSVPVAHIFEEDGQISSATFEAEISKYLSQIEN
Uniprot No.

Target Background

Function

A nonessential component of the signal peptidase complex (SPC), spc2 catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum. This signal peptide cleavage occurs co-translationally or post-translationally during translocation through the translocon pore into the endoplasmic reticulum. Spc2 enhances SPC enzymatic activity and facilitates interactions between components at the translocation site.

Database Links
Protein Families
SPCS2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Signal Peptidase Complex subunit 2 (spc2) in S. pombe?

Signal peptidase complex subunit 2 (spc2) is a non-catalytic component of the signal peptidase complex in Schizosaccharomyces pombe. It is encoded by the spc2 gene (SPAC1071.04c) and has the UniProt accession number Q9UTQ9. While not essential for basic signal peptidase activity, spc2 plays a functionally distinct role from other subunits like Spc1p and is particularly important for signal peptidase activity and cell viability at elevated temperatures .

How does spc2 function within the signal peptidase complex?

Although spc2 is noncatalytic, it contributes significantly to the structural integrity and optimal function of the signal peptidase complex. Research has shown that spc2 exhibits synthetic lethality with conditional mutations in Sec11p, an essential catalytic subunit of the signal peptidase. Unlike Spc1p, spc2 cannot suppress conditional sec11 mutations when overexpressed, indicating that these two structurally related subunits perform distinct biological functions within the complex .

What phenotypes are associated with spc2 deletion in S. pombe?

MutationViabilityTemperature SensitivitySynthetic Interactions
spc2ΔViableSensitive to high temperatureSynthetic lethal with sec11 conditional mutations
spc1Δ spc2ΔViable but growth defectsIncreased sensitivityNot described in provided data
spc2Δ sec11(ts)LethalN/ASynthetic lethality

Why is S. pombe preferred over other yeast models for studying signal peptidase complexes?

S. pombe offers several advantages for studying signal peptidase complexes compared to Saccharomyces cerevisiae. As a fission yeast divergent from budding yeast, S. pombe shares more features with humans including gene structures, chromatin dynamics, and prevalence of introns. It also exhibits similarities in cellular processes such as pre-mRNA splicing, epigenetic gene silencing, and RNAi pathways . These characteristics make S. pombe an excellent "micromammal" model for investigating signal peptidase function in a system more closely related to higher eukaryotes while maintaining the experimental advantages of yeast.

How can the haploid/diploid switching capability of S. pombe benefit spc2 research?

S. pombe's ability to alternate between haploid and diploid states provides a powerful experimental advantage for spc2 research. In haploid strains carrying loss-of-function mutations in spc2, recessive phenotypes are readily observable under appropriate conditions. Conversely, diploid strains can be used for haploinsufficiency assays to assess spc2 gene dosage effects by comparing heterozygous and homozygous strains. This controlled regulation of ploidy states facilitates genetic dissection of spc2 function and its interactions with other signal peptidase components .

What genetic tools are available for manipulating spc2 in S. pombe?

S. pombe offers a comprehensive toolkit for genetic manipulation of spc2, including:

  • Gene deletion/replacement strategies using homologous recombination with selection markers (e.g., ura4+)

  • Conditional expression systems using regulatable promoters (e.g., nmt promoters in pREP vectors)

  • Epitope tagging for protein localization and interaction studies

  • Temperature-sensitive mutant generation for functional analysis

  • Integration of mutations at the native locus using CRISPR-Cas9 or traditional methods

These approaches can be combined with phenotypic analyses including growth assays, microscopy, and biochemical characterization of signal peptidase activity .

How can I efficiently express and purify recombinant S. pombe spc2 for structural studies?

For structural studies of recombinant S. pombe spc2, a multi-step approach is recommended:

  • Expression system selection: E. coli BL21(DE3) with pET-based vectors containing a 6×His or GST tag is effective for initial trials. For proper folding, consider using S. pombe or insect cell expression systems.

  • Optimization protocol:

    • Induce expression at lower temperatures (16-20°C) to enhance solubility

    • Include detergents (0.1-1% Triton X-100 or NP-40) in lysis buffers as spc2 is membrane-associated

    • Add protease inhibitors to prevent degradation

    • Consider using mild solubilization agents like sarkosyl followed by dilution with Triton X-100

  • Purification strategy:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged protein)

    • Ion exchange chromatography as an intermediate step

    • Size exclusion chromatography for final polishing and buffer exchange

    • Maintain 10-15% glycerol in all buffers to enhance stability

This approach has been successfully employed for similar membrane-associated signal peptidase components and can be adapted for structural studies of spc2 using X-ray crystallography or cryo-EM .

What approaches can be used to study spc2 interactions within the signal peptidase complex?

Multiple complementary approaches can be employed to characterize spc2 interactions:

The SMN complex structural analysis in S. pombe provides a template for such studies, where researchers successfully combined X-ray crystallography, homology modeling, and SAXS analysis to determine complex architecture .

How can I analyze the functional consequences of spc2 mutations on signal peptide processing?

To analyze how spc2 mutations affect signal peptide processing, implement this comprehensive workflow:

  • Generation of mutant strains:

    • Create point mutations, truncations, or domain swaps in spc2

    • Integrate mutations at the endogenous locus

    • Generate temperature-sensitive alleles if studying essential functions

  • Reporter systems:

    • Express model secretory proteins with intact signal peptides (e.g., acid phosphatase)

    • Use fluorescent protein fusions to visualize secretion efficiency

    • Implement split reporter systems where signal peptide cleavage activates a detectable output

  • Analytical methods:

    • Western blotting to detect shifts in molecular weight after signal peptide cleavage

    • Pulse-chase analysis to measure processing kinetics

    • Mass spectrometry to precisely identify cleavage sites

    • Subcellular fractionation to assess protein localization

  • Quantification parameters:

    • Processing efficiency (% processed/total)

    • Processing kinetics (half-time to cleavage)

    • Fidelity (correct vs. incorrect cleavage site usage)

    • Impact on downstream protein folding/secretion

This approach has been validated in studies of signal peptidase function, showing that while spc2 deletion alone causes subtle defects, these become pronounced under stress conditions or in combination with mutations in other complex components .

What are the critical factors affecting the solubility of recombinant spc2?

Recombinant spc2 solubility is influenced by several critical factors:

  • Expression temperature: Lower temperatures (16-20°C) significantly improve solubility by slowing protein synthesis and allowing proper folding.

  • Buffer composition:

    • pH optimization (typically 7.0-8.0)

    • Salt concentration (300-500 mM NaCl reduces aggregation)

    • Addition of 5-10% glycerol stabilizes the protein

    • Mild detergents (0.1% DDM or CHAPS) maintain native conformation

    • Reducing agents (1-5 mM DTT or 2-ME) prevent disulfide-mediated aggregation

  • Fusion tags:

    • Solubility-enhancing tags (MBP, SUMO, or thioredoxin)

    • Position of tag (N-terminal tags typically more effective)

    • Impact of tag removal on stability

  • Co-expression strategies:

    • Co-expression with other signal peptidase components (especially Sec11p)

    • Molecular chaperones (GroEL/ES, DnaK/J-GrpE)

These parameters must be systematically optimized through small-scale expression trials before scaling up for structural or functional studies.

How can I assess the proper folding and activity of recombinant spc2?

Assessing proper folding and activity of recombinant spc2 requires multiple complementary approaches:

These methods provide comprehensive evaluation of recombinant spc2 quality before proceeding to complex structural or mechanistic studies.

What are the recommended storage conditions for maintaining spc2 stability?

To maintain optimal stability of purified recombinant spc2, follow these evidence-based storage recommendations:

  • Short-term storage (1-2 weeks):

    • Temperature: 4°C

    • Buffer: 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTT

    • Add protease inhibitors (e.g., EDTA-free protease inhibitor cocktail)

    • Keep protein concentration below 1 mg/ml to prevent aggregation

  • Long-term storage (months to years):

    • Flash-freeze in liquid nitrogen and store at -80°C

    • Add additional stabilizers: 15-20% glycerol or 10% sucrose

    • Aliquot in small volumes (50-100 μl) to avoid freeze-thaw cycles

    • Consider lyophilization for constructs demonstrated to recover activity

  • Stability enhancers:

    • Add 0.05-0.1% non-ionic detergents for membrane-associated constructs

    • Include 1 mM EDTA to chelate metal ions that might promote oxidation

    • For specific applications, add 100 mM L-arginine and L-glutamate as stabilizers

  • Quality control measures:

    • Perform activity tests after storage to confirm retention of function

    • Run analytical SEC to detect aggregation after thawing

    • Validate long-term storage conditions empirically for each construct

These storage protocols are based on empirical data from membrane protein biochemistry and have been applied successfully to signal peptidase components.

How does the S. pombe signal peptidase complex compare to that of other organisms?

The signal peptidase complex shows both conservation and diversity across species:

OrganismCore Catalytic SubunitAuxiliary SubunitsKey Differences
S. pombeSec11Spc1, Spc2, Spc3Spc2 is important for temperature tolerance
S. cerevisiaeSec11pSpc1p, Spc2p, Spc3pSpc1p can suppress sec11 mutations
MammalsSPC18/21SPC12, SPC22/23, SPC25More complex with additional regulatory mechanisms
E. coliLepBNone (monomeric)Simpler architecture, different catalytic mechanism

Key differences in the S. pombe complex include:

  • Functional distinction between Spc1 and Spc2, with Spc2 specifically important for high-temperature activity

  • Different genetic interactions with the catalytic Sec11 subunit

  • Unique temperature-sensitive phenotypes associated with spc2 deletion

  • Viability of double spc1Δ spc2Δ mutants, though with growth defects compared to wild-type

This evolutionary comparison provides insight into conserved and specialized functions of signal peptidase components across species.

How can spc2 research contribute to understanding human disease mechanisms?

Research on S. pombe spc2 can illuminate human disease mechanisms through several connections:

  • Protein trafficking disorders:
    Signal peptidase dysfunction is implicated in various human diseases involving protein mislocalization. S. pombe spc2 research provides a simplified model to understand fundamental mechanisms of signal peptide processing that are conserved in humans.

  • Neurodegenerative diseases:
    Protein misfolding and ER stress resulting from improper signal sequence processing contribute to neurodegenerative conditions. The temperature-sensitive phenotypes of spc2 mutants provide models for studying how cellular stress affects signal peptidase function .

  • Congenital disorders of glycosylation:
    Many glycoproteins require proper signal peptide processing for correct localization and modification. Studying spc2's role in signal peptidase complex function can reveal mechanisms underlying these disorders.

  • Therapeutic target identification:
    Understanding the structural and functional relationships within the signal peptidase complex through spc2 research may identify novel interaction interfaces for therapeutic intervention in diseases associated with protein trafficking defects.

The genetic tractability of S. pombe makes it an excellent system for modeling disease-associated mutations in signal peptidase components and screening for genetic or chemical suppressors with therapeutic potential.

What advanced genetic interaction studies can reveal spc2's broader cellular functions?

Advanced genetic interaction studies can uncover spc2's broader cellular functions through several sophisticated approaches:

  • Synthetic genetic array (SGA) analysis:

    • Cross spc2Δ or conditional spc2 mutants with genome-wide deletion/mutant libraries

    • Identify synthetic lethal, sick, or suppressor interactions

    • Construct genetic interaction networks to position spc2 in cellular pathways

    • Quantify interaction strengths to identify the most significant functional relationships

  • Differential genetic interaction mapping:

    • Compare genetic interaction profiles of spc2 with other signal peptidase components

    • Identify unique vs. shared interaction partners to distinguish specific functions

    • Perform comparative analysis under different stress conditions (temperature, ER stress)

  • Genome-wide CRISPR screens:

    • Implement CRISPR-based screens in spc2 mutant backgrounds

    • Identify suppressors or enhancers of spc2-associated phenotypes

    • Target non-coding regions to identify regulatory elements affecting spc2 function

  • Multi-omics integration:

    • Combine genetic interaction data with:

      • Transcriptomics to identify compensatory responses

      • Proteomics to detect changes in protein complexes

      • Metabolomics to reveal altered cellular pathways

    • Develop predictive models of spc2 function in cellular homeostasis

These approaches have successfully revealed unexpected connections between seemingly unrelated cellular processes and can position spc2 within the broader context of cellular function beyond its immediate role in signal peptidase activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.