The recombinant Schizosaccharomyces pombe solute carrier family 25 member 38 homolog (SPAC823.10c) is a mitochondrial carrier protein expressed in fission yeast (S. pombe). It belongs to the solute carrier family 25 (SLC25), which encompasses mitochondrial transporters critical for shuttling metabolites, ions, and cofactors across the inner mitochondrial membrane. This recombinant protein is produced for research purposes, enabling structural, functional, and biochemical studies of mitochondrial transport mechanisms.
The protein sequence includes conserved motifs characteristic of SLC25 family members, such as:
MSEIKKTEKLGVKSSKHLAAGALGGFISSTTLQPLDLLKTRCQQSQRDSLPKMVRRIILH...
This sequence is critical for membrane integration and substrate recognition .
SPAC823.10c is localized to the inner mitochondrial membrane, where it facilitates the transport of metabolites. While its exact substrate specificity remains under investigation, homologous proteins in S. pombe (e.g., mitochondrial carriers) are involved in:
UV-Toxicity Modulation: SPAC823.10c has been linked to UV-toxicity responses in S. pombe, suggesting a role in stress adaptation or DNA repair pathways .
Metabolic Flux Analysis: Studies on S. pombe mitochondrial carriers highlight their importance in coordinating cytosolic and mitochondrial metabolism, including pyruvate and NADH channeling .
Purity and Stability:
Functional Homology:
KEGG: spo:SPAC823.10c
STRING: 4896.SPAC823.10c.1
S. pombe serves as an exceptional model organism for studying mitochondrial carrier proteins like SPAC823.10c due to its remarkable similarities to human cells in mitochondrial inheritance, transport mechanisms, and metabolism. The organism's petite-negative phenotype (dependence on functional mitochondria for viability) makes it particularly valuable for investigating essential mitochondrial carrier proteins .
For functional characterization, consider these approaches:
Gene knockout/deletion using commercially available deletion libraries
Fluorescent tagging with GFP for localization studies
Conditional expression systems using repressible/inducible promoters
Complementation studies with human homologs
The systematic deletion approach has proven highly effective, as demonstrated in comprehensive phenotypic screening studies that combine high-resolution imaging with machine learning classification for phenotypic characterization .
Given SPAC823.10c's putative role as a mitochondrial carrier protein, several phenotypic assays can provide functional insights:
Recommended multi-parameter phenotypic analysis pipeline:
Cell morphology assessment: Implement 3D fluorescence imaging with automated segmentation to extract 57 shape and grey-level features (length, width, area, convexity, etc.) as described in comprehensive phenotypic screening protocols .
Mitochondrial network visualization: Use fluorescent markers to evaluate mitochondrial morphology, distribution, and dynamics.
Cell cycle progression analysis: Apply machine learning classifiers to categorize cells into different cycle stages with >93% accuracy, even when mitochondrial phenotypes are abnormal .
Growth rate measurements: Compare doubling times in different carbon sources to assess metabolic dependencies.
Stress response assays: Test sensitivity to oxidative stress, temperature variation, and metabolic inhibitors.
The most informative approach combines multiple parameters rather than relying on single measurements, as subtle phenotypic alterations can collectively reveal significant functional insights .
For the recombinant production of membrane proteins like SPAC823.10c, consider these expression systems with their respective advantages:
| Expression System | Advantages | Considerations for SPAC823.10c |
|---|---|---|
| Native S. pombe | Proper folding, authentic post-translational modifications | Limited yield, challenging purification |
| S. cerevisiae | Higher expression levels, various vector options | Potential differences in mitochondrial import machinery |
| E. coli | High yield, simplified purification | May require refolding, lacks post-translational modifications |
| Mammalian cells | Human-like processing, suitable for functional studies | Complex protocols, higher cost |
For functional studies, expressing SPAC823.10c with a C-terminal tag in S. pombe is recommended to preserve native membrane insertion and folding patterns. For structural studies requiring higher yields, E. coli expression with subsequent membrane reconstitution may be necessary, though protein activity should be verified.
Analyze SPAC823.10c expression patterns using RNA-seq approaches designed for temporal transcriptional data:
Data preprocessing: Use specialized packages like MultiRNAflow for RNAseq data normalization to prepare count data from multiple conditions and/or time points .
Expression profiling: Implement the DATAplotExpressionGenes() function to visualize SPAC823.10c expression across experimental conditions .
Temporal pattern analysis: Apply MFUZZanalysis() for clustering genes with similar temporal expression behaviors to identify co-regulated genes .
Statistical analysis: Employ DEanalysisGlobal() to identify differential expression patterns specific to particular conditions or timepoints .
Visualization: Generate heatmaps, volcano plots, and PCA visualizations using DEplotVolcanoMA() and DEplotHeatmaps() functions to identify condition-specific signatures .
This methodological framework allows robust identification of experimental conditions affecting SPAC823.10c expression and reveals co-regulated genes that may function in related pathways.
Implement a multi-process phenotypic screening approach combining automated high-resolution imaging with quantitative multiparametric analysis:
Comprehensive phenotypic profiling pipeline:
3D confocal microscopy: Collect high-resolution xyz image stacks to capture subcellular information from individual cells expressing fluorescently-tagged proteins .
Multiparametric feature extraction: Apply computational image analysis to extract 57+ shape and intensity features from each cell .
Machine learning classification: Train Random Forest classifiers to identify subtle phenotypic deviations with >90% accuracy .
Complementary hit detection strategies: Combine single-feature analysis ("p-value" approach) with multiparametric profile scoring to detect both prominent alterations and multiple subtle feature changes .
Biological validation: Perform 10-fold independent screening rounds to generate high-confidence hit lists (≥35% confidence value), ensuring reproducibility of observed phenotypes .
This approach has successfully identified hundreds of cell shape (372), microtubule (449), and cell cycle progression (199) hits in genome-wide screens , enabling comprehensive functional characterization of genes with subtle phenotypes that traditional approaches might miss.
SPAC823.10c functional characterization benefits significantly from cross-species analysis approaches:
Ortholog identification: Identify human and other model organism homologs through sequence analysis and evolutionary conservation patterns of mitochondrial carrier family members.
Functional conservation testing: Determine whether human homologs can rescue S. pombe SPAC823.10c deletion phenotypes.
Network inference: Apply cross-species gene regulatory network inference algorithms that merge microarray datasets based on co-expression patterns without requiring pre-established orthology information .
Conservation mapping: Analyze which functional domains and regulatory elements are most conserved across species to identify critical regions for targeted mutagenesis.
This cross-species approach provides evolutionary context for functional studies and increases translational relevance for human health applications. The co-expression-based network inference is particularly valuable for proteins like SPAC823.10c where direct functional data may be limited in certain species .
When confronting conflicting evidence about SPAC823.10c localization:
Multi-tag validation: Compare results using different tagging approaches (N-terminal, C-terminal, internal tags) to identify potential artifacts from tag interference.
Live cell versus fixed sample comparison: Evaluate whether fixation protocols affect apparent localization.
Colocalization with multiple organelle markers: Quantify overlap with mitochondrial, ER, and other compartment markers using statistical colocalization measures.
Biochemical fractionation: Complement imaging with subcellular fractionation and Western blotting to verify localization biochemically.
Inducible targeting: Employ spatiotemporally controlled expression systems to monitor protein trafficking in real-time.
Decision matrix for resolving contradictory localization data:
| Method | Strengths | Limitations | Application to SPAC823.10c |
|---|---|---|---|
| 3D live imaging | Captures dynamic behavior | Requires functional tag | Primary approach for initial characterization |
| Super-resolution microscopy | Resolves suborganellar localization | Specialized equipment needed | Secondary validation of mitochondrial subcompartments |
| Correlative light/EM | Ultrastructural context | Labor intensive | Definitive resolution of ambiguous results |
| Functional complementation | Links location to function | Indirect evidence | Confirmation of biologically relevant localization |
Implementing this systematic approach ensures accurate localization determination despite technical variables that might create conflicting results.
To analyze SPAC823.10c expression dynamics throughout the cell cycle:
Synchronized culture analysis: Apply cell cycle synchronization techniques specific to S. pombe (nitrogen starvation/release, hydroxyurea block/release, or cdc mutant temperature shifts).
Time-resolved RNA-seq: Collect samples at regular intervals and process using MultiRNAflow's temporal analysis pipeline .
Clustering of temporal patterns: Implement MFUZZanalysis() to identify genes with expression patterns similar to SPAC823.10c, revealing potential co-regulated networks .
Multi-dimensional visualization: Generate 3D PCA plots and temporal heatmaps to visualize complex expression changes across time and experimental conditions .
Automated cell cycle stage classification: Apply machine learning-based cell cycle stage assignment for correlating expression with particular stages with >93% accuracy .
This comprehensive approach enables precise correlation between SPAC823.10c expression fluctuations and specific cell cycle events, providing insights into its regulatory mechanisms and potential cell cycle-related functions.
As a putative mitochondrial carrier protein, SPAC823.10c's transport activity requires specialized characterization techniques:
Reconstitution in liposomes: Purify recombinant protein and reconstitute in artificial membrane systems to measure substrate transport directly.
Metabolomic profiling: Compare metabolite levels between wild-type and SPAC823.10c deletion strains to identify accumulated or depleted substrates.
Mitochondrial transport assays: Isolate mitochondria from wild-type and mutant strains to measure substrate uptake rates.
Genetic suppressor screens: Identify suppressors of SPAC823.10c deletion phenotypes that may represent alternative transport pathways or downstream effectors.
Structure-guided mutagenesis: Target conserved residues in predicted substrate-binding regions to alter transport specificity or efficiency.
These complementary approaches allow determination of transport kinetics, substrate specificity, and regulatory mechanisms controlling SPAC823.10c activity, critical for understanding its physiological role in mitochondrial metabolism.
To conduct comprehensive gene ontology analysis for SPAC823.10c:
Differential expression analysis: Identify genes with altered expression in SPAC823.10c mutants using DEanalysisGlobal() .
GO enrichment analysis: Apply GSEAQuickAnalysis() with the gprofiler2 package to identify overrepresented biological processes, molecular functions, and cellular components .
Multi-platform validation: Generate formatted outputs for additional analysis using specialized tools like DAVID, Webgestalt, GSEA, gProfiler, Panther, ShinyGO, Enrichr, and GOrilla through GSEApreprocessing() .
Network visualization: Create interactive functional networks connecting SPAC823.10c to enriched pathways and processes.
This methodological framework provides robust functional context for SPAC823.10c by systematically identifying biological processes affected by its absence or dysfunction, generating testable hypotheses about its cellular roles.
When designing CRISPR-Cas9 editing approaches for SPAC823.10c, consider:
Genome context assessment: Evaluate nearby essential genes or regulatory elements that could be disrupted by editing.
PAM site selection: Identify optimal protospacer adjacent motif (PAM) sites that minimize off-target effects while enabling precise modification.
Repair template design: For knock-in applications, design repair templates with appropriate homology arms and necessary modifications.
Validation strategy planning: Develop PCR primers, sequencing strategies, and phenotypic assays to confirm successful editing.
Phenotypic confirmation: Implement the established phenotypic profiling pipeline to verify that engineered mutations produce expected functional consequences .
Critical parameters for successful CRISPR editing of SPAC823.10c:
| Parameter | Recommendation | Rationale |
|---|---|---|
| gRNA length | 20 nucleotides | Optimal balance of specificity and efficiency |
| Homology arm length | ≥500 bp each side | Ensures efficient homologous recombination |
| PAM selection | Prioritize NGG sites in non-conserved regions | Reduces potential functional disruption |
| Control design | Include wild-type and empty vector controls | Distinguishes editing effects from technical artifacts |
| Phenotypic validation | Multi-parameter assessment | Captures subtle functional changes |
This comprehensive approach ensures precise and functionally validated genetic modifications of SPAC823.10c.
Leverage machine learning for sophisticated phenotypic characterization:
Feature extraction optimization: Extract 57+ cellular features from high-resolution 3D image data, capturing shape, intensity, and distribution parameters .
Classifier training: Develop Random Forest classifiers using both wild-type and known phenotypic mutant training sets to achieve >90% classification accuracy .
Cell cycle stage assignment: Implement automated cell cycle classification even when dealing with abnormal phenotypes (93.78% accuracy across wild-type and mutant cells) .
Multi-dimensional phenotypic signatures: Generate composite phenotypic signatures reflecting cell shape, microtubule organization, and cell cycle progression characteristics .
Cluster analysis: Group phenotypically similar mutants to identify genes in common pathways, revealing functional relationships with SPAC823.10c .
This machine learning-enhanced approach has demonstrated success in genome-wide screens, analyzing millions of images and cells to identify subtle phenotypic signatures that would be missed by conventional methods .
To distinguish primary from secondary consequences of SPAC823.10c disruption:
Temporal analysis: Track phenotypic and transcriptional changes over time following conditional SPAC823.10c inactivation to identify earliest effects.
Rescue experiments: Test whether acute expression of SPAC823.10c can reverse established phenotypes in deletion strains.
Substrate supplementation: Determine if providing putative transported substrates can bypass the requirement for SPAC823.10c.
Epistasis analysis: Combine SPAC823.10c mutations with mutations in suspected pathway components to determine genetic relationships.
Direct biochemical interactions: Identify physical interaction partners through approaches like BioID, proximity labeling, or co-immunoprecipitation.
This multi-faceted approach helps establish causal relationships between SPAC823.10c function and observed phenotypes, distinguishing its primary molecular role from downstream consequences of its disruption.
Implement a multi-omics integration strategy:
Synchronized experimental design: Collect matched samples for both transcriptomic and proteomic analysis under identical conditions.
RNA-seq analysis: Process transcriptomic data using established pipelines for differential expression and temporal pattern analysis .
Quantitative proteomics: Perform label-free or isotope-labeled quantitative proteomics on matched samples.
Computational integration: Apply correlation analysis to identify concordant and discordant changes between transcript and protein levels.
Network reconstruction: Develop integrated regulatory networks incorporating both transcriptional and post-transcriptional regulation.
This integration reveals regulatory mechanisms affecting SPAC823.10c and identifies cases where post-transcriptional processes significantly impact protein function, providing a more complete understanding than either approach alone.
To ensure robust, reproducible research outcomes:
Statistical power planning: Design experiments with sufficient biological replicates (minimum n=3) and appropriate controls based on expected effect sizes.
Technical validation: Implement 10-fold biological validation for key findings, as demonstrated in high-confidence phenotypic screening approaches .
Standardized growth conditions: Carefully control media composition, temperature, and growth phase to minimize experimental variability.
Multiple detection methods: Confirm key findings using orthogonal techniques (e.g., validate RNA-seq results with qPCR).
Data transparency: Document all experimental parameters, analysis pipelines, and computational tools with version information.
This rigorous approach ensures that functional characterizations of SPAC823.10c will be robust and reproducible across different research environments, a critical factor for building reliable scientific knowledge.