Recombinant Schizosaccharomyces pombe Sphingosine N-acyltransferase lac1 (lac1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
lac1; mug83; SPBC3E7.15c; SPBC4F6.02c; Sphingosine N-acyltransferase lac1; Meiotically up-regulated gene 83 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
lac1
Target Protein Sequence
MGNNTSRRSQSQKFKNIPSISAGSFSTMPVQHRGRRRRSKSIVGRAAQNAVLRSKEKTWI VPLILLTLLVGWYFVNPNGYIKYGIFLSYPIPGTNPAQYGKGRLDIAFCLFYALFFTFCR EFIMQEIIARIGRHFNIRAPAKLRRFEEQAYTCLYFTVMGSWGLYVMKQTPMWFFNTDAF WEEYPHFYHVGSFKAFYLIEAAYWIQQALVLILQLEKPRKDFKELVVHHIITLLLIGLSY YFHFTWIGLAVFITMDTSDIWLALSKCLNYVNTVIVYPIFVIFVFVWIYMRHYLNFKIMW AVWGTMRTINSFDLDWAAEQYKCWISRDVTLILLTALQLVNIYWLILILRIGYRAFTTND THDERSEDEDEEVSDEKSSAKKND
Uniprot No.

Target Background

Function
This protein is a component of the ceramide synthase complex, essential for C26-CoA-dependent ceramide synthesis. It facilitates ER-to-Golgi transport of GPI-anchored proteins and plays a role in meiosis.
Gene References Into Functions
  1. Loss of *S. pombe lac1* results in heat shock sensitivity and disruption of plasma membrane sterol distribution. PMID: 18441123
Database Links
Protein Families
Sphingosine N-acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Sphingosine N-acyltransferase lac1 in Schizosaccharomyces pombe?

Sphingosine N-acyltransferase lac1 in Schizosaccharomyces pombe is a gene that encodes a homologue of proteins required for ceramide synthesis, a crucial component of sphingolipid metabolism. The lac1 gene product functions as a key enzyme that catalyzes the N-acylation of sphingoid bases with acyl-CoA to generate ceramides, similar to its homologues in other fungi such as Saccharomyces cerevisiae (budding yeast) . In S. pombe, lac1 forms a complex with a regulatory subunit called Lip1, which is essential for the proper functioning of the enzyme. This complex plays a significant role in cell membrane structure, signaling pathways, and importantly, in modulating cellular responses to various drugs and stressors .

What is the structural organization of the lac1 protein?

The lac1 protein contains eight transmembrane domains (TMs), labeled TM1-TM8, with both N- and C-termini facing the cytosol. The protein structure can be divided into two main domains: the N-terminal domain (NTD) consisting of TM1-TM2, and the TLC (TRAM-LAG1-CLN8) domain formed by TM3-TM8 . The structure reveals three long luminal loops connecting TM1/2, TM3/4, and TM7/8, respectively. Additionally, the protein contains three short helices: one cytosolic helix (CH1) preceding TM1 and two luminal helices (LH1 and LH2) located within the TM1/2 and TM3/4 loops . The TLC domain forms a large hydrophilic cavity within the membrane that opens to the cytosolic side, which serves as the active site for the N-acyltransferase reaction.

How does lac1 interact with the Lip1 regulatory subunit?

The Lip1 regulatory subunit forms a complex with lac1 and is essential for its enzymatic activity. Biochemical studies have demonstrated that although lac1 can fold properly without Lip1, as evidenced by its monodisperse peak in size-exclusion chromatography, it shows no enzymatic activity in the absence of Lip1 . The Lac1-Lip1 complex functions as the active ceramide synthase in S. pombe. Structural and mutational analyses suggest that Lip1 enhances the catalytic activity of the complex by engaging in lac1 interaction and participating in acyl chain binding, similar to the stimulatory role of small regulatory subunits in human sphingolipid biosynthetic enzymes . This interaction is crucial for the optimal functioning of the enzyme in ceramide synthesis.

What is the relationship between lac1 and lag1 in fungal species?

In Saccharomyces cerevisiae, both Lag1 and Lac1 are distinct members of the ceramide synthase family that catalyze the N-acylation of sphingoid bases (dihydrosphingosine or phytosphingosine) with the preferred C26-CoA to generate dihydroceramide or phytoceramide . While they perform similar functions, the purified Lac1-Lip1 complex exhibits much higher enzymatic activity (approximately 20 times) compared to the Lag1-Lip1 complex. In S. pombe, a similar relationship exists, and interestingly, the multidrug-sensitive phenotype of rav1 mutants can be rescued by up-regulation of the lag1 gene, which encodes a homologue of lac1 . This suggests functional redundancy between these genes, though they may have specialized roles or expression patterns in different cellular contexts or developmental stages.

What experimental approaches are used to study lac1 enzymatic activity?

Several sophisticated experimental approaches are employed to study lac1 enzymatic activity:

  • Colorimetric Assays: Researchers use DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)) to monitor the release of free CoA-SH from the N-acyltransferase reaction, providing a quantitative measure of enzyme activity . This allows for real-time monitoring of reaction kinetics under various conditions.

  • Substrate Concentration Analysis: Activity curves with varying concentrations of substrates (C26-CoA or DHS) are generated to understand enzyme kinetics. DHS concentration curves follow Michaelis-Menten equations, while C26-CoA concentration curves fit with allosteric sigmoidal equations, suggesting a regulatory role for C26-CoA .

  • Site-Directed Mutagenesis: Mutations of conserved residues, such as the H255A/H256A mutations in the Lag1p motif, result in complete loss of enzymatic activity, helping identify catalytically critical amino acids .

  • Recombinant Protein Expression and Purification: Expression systems for producing the Lac1-Lip1 complex and Lac1 alone allow comparative studies of protein folding and activity, demonstrating that while Lac1 can fold independently, Lip1 is essential for enzymatic function .

  • Structural Analysis: Techniques such as cryo-electron microscopy provide insights into the three-dimensional structure of the Lac1-Lip1 complex, revealing key features such as the hydrophilic reaction chamber and substrate binding sites .

Experimental ApproachPurposeKey Findings
Colorimetric Assays (DTNB)Measure enzyme activityCan detect release of CoA-SH from N-acyltransferase reaction
Substrate KineticsUnderstand regulationDHS follows Michaelis-Menten kinetics; C26-CoA shows allosteric behavior
Site-Directed MutagenesisIdentify critical residuesH255A/H256A mutations in Lag1p motif abolish activity
Recombinant ExpressionCompare complex vs. individual componentsLac1 folds without Lip1 but requires Lip1 for activity
Structural AnalysisReveal 3D organizationIdentified 8 TMs, hydrophilic cavity, and substrate binding sites

How does lac1 contribute to multidrug resistance in S. pombe?

Lac1 plays a significant role in multidrug resistance (MDR) in S. pombe through multiple mechanisms related to ceramide synthesis and membrane composition:

The overexpression of lac1 or its homologue lag1 confers multidrug resistance on wild-type cells, indicating that increased ceramide synthase activity enhances innate drug resistance . Conversely, lac1 mutations result in increased sensitivity to drugs such as doxorubicin. Studies using the naturally fluorescent properties of doxorubicin have shown that lac1 mutations lead to increased accumulation of the drug in cells, suggesting altered membrane permeability or reduced drug efflux capability .

The mechanism likely involves changes in membrane composition and structure due to altered ceramide levels. Ceramides are critical components of cell membranes and influence membrane fluidity, microdomain formation, and the function of membrane-embedded transporters that may be involved in drug efflux. Additionally, ceramides and their metabolites serve as signaling molecules that can affect stress response pathways and cell survival mechanisms when exposed to cytotoxic compounds .

This connection between ceramide synthesis and drug resistance is particularly significant because the lac1 gene is conserved in both higher eukaryotes and various pathogenic fungi, suggesting that strategies targeting lac1 function could be developed to sensitize drug-resistant tumor cells or pathogenic fungi to chemotherapeutic agents .

What is the structure-function relationship of the lac1 catalytic site?

The catalytic site of lac1 resides within a large hydrophilic cavity formed by the TLC domain (TM3-TM8) that opens to the cytosolic side of the membrane. Critical to the function of this catalytic site are four highly conserved charged residues within the Lag1p motif (TM5-TM6): His255, His256, Asp283, and Asp286 . These residues are buried inside the cavity with their side chains facing inward, positioning them to interact with substrates and facilitate catalysis.

Structural analysis reveals that the hydrophilic CoA moiety of C26-CoA binds within this cavity, positioning the thioester bond close to the conserved His and Asp residues . This arrangement strongly suggests that these conserved residues participate directly in substrate binding and/or catalysis of the acyl-transfer reaction that occurs within the membrane.

Mutational studies confirm the critical nature of these residues, as the H255A/H256A double mutation results in complete loss of enzymatic activity . This structure-function relationship is consistent across the CerS family of enzymes, indicating a conserved catalytic mechanism for ceramide synthesis.

Additional residues in Lac1 contribute to acyl chain binding and proper positioning of substrates. Mutations of these residues can result in partial or complete loss of catalytic activity, highlighting their importance in the enzymatic function . The spatial arrangement of the active site facilitates the N-acylation reaction by bringing together the sphingoid base and acyl-CoA in an optimal orientation for catalysis.

How can researchers manipulate lac1 expression to study drug sensitivity?

Researchers can employ several strategies to manipulate lac1 expression for studying drug sensitivity:

  • Gene Knockout/Knockdown: Generating lac1 deletion mutants or using RNA interference techniques to reduce lac1 expression can create cellular models with increased drug sensitivity, particularly to compounds like doxorubicin .

  • Overexpression Systems: Plasmid-based overexpression of lac1 or lag1 can be used to confer multidrug resistance on wild-type cells, allowing the study of resistance mechanisms and potential interventions .

  • Site-Directed Mutagenesis: Creating specific mutations in the lac1 gene, particularly in the conserved catalytic residues (H255, H256, D283, D286) or substrate binding regions, provides insights into structure-function relationships and their impact on drug sensitivity .

  • Regulated Promoter Systems: Using inducible promoters to control lac1 expression levels allows for temporal studies of how changing ceramide synthesis capacity affects drug resistance acquisition or loss.

  • Complementation Studies: Complementing lac1 mutations with wild-type or mutant variants can determine which domains or functions are critical for drug resistance phenotypes .

For experimental design, researchers should consider:

  • Using appropriate drug concentrations based on the expected sensitivity changes

  • Including controls for gene expression levels and enzymatic activity

  • Monitoring changes in ceramide composition as a result of expression manipulation

  • Assessing drug accumulation using fluorescent drugs like doxorubicin

  • Examining potential changes in vacuolar (H+)-ATPase function, as lac1 mutations can affect V-ATPase activity indirectly

What is the role of lac1 in vacuolar ATPase function and drug sensitivity?

The relationship between lac1 and vacuolar ATPase (V-ATPase) function represents a complex interplay between ceramide synthesis and cellular pH regulation:

Studies have shown that in S. pombe, mutations in lac1 can impact V-ATPase function, though the mechanism appears to be indirect. The V-ATPase is a large, multisubunit complex found in the membranes of several organelles such as the Golgi apparatus and vacuoles, where it functions to acidify these compartments by pumping protons across membranes . Proper V-ATPase function is critical for various cellular processes, including protein sorting, membrane trafficking, and drug detoxification.

The connection between lac1 and V-ATPase function likely involves the role of ceramides in membrane composition and organization. Altered ceramide levels due to lac1 mutation may affect the lipid environment of the V-ATPase complex, potentially disrupting its assembly, stability, or activity. This disruption of normal V-ATPase function results in an increased sensitivity of S. pombe cells to various drugs .

Interestingly, this mechanism parallels that observed with rav1 mutations. Rav1 is part of a RAVE-like complex in fission yeast that directly regulates V-ATPase assembly. Loss of rav1 results in defects in V-ATPase activity and also leads to increased drug sensitivity . The phenotypic similarity between lac1 and rav1 mutants suggests convergent pathways affecting V-ATPase function and consequently drug sensitivity.

This relationship between ceramide synthesis, V-ATPase function, and drug sensitivity represents a promising area for developing strategies to overcome drug resistance in pathogenic fungi or cancer cells by targeting either ceramide synthesis or V-ATPase regulation .

How should researchers design experiments to study lac1 enzymatic kinetics?

To effectively study lac1 enzymatic kinetics, researchers should implement a systematic experimental design that addresses multiple aspects of enzyme function:

  • Substrate Preparation and Purity: Use high-purity sphingoid bases (DHS or PHS) and various acyl-CoAs (particularly C26-CoA) as substrates. Substrate purity is critical for accurate kinetic measurements .

  • Enzyme Preparation: Express and purify the Lac1-Lip1 complex using recombinant systems that ensure proper folding and post-translational modifications. Size-exclusion chromatography should be employed to verify complex formation and homogeneity .

  • Activity Assay Optimization: Implement the DTNB-based colorimetric assay to monitor CoA-SH release, with optimization of buffer conditions, pH, temperature, and ionic strength to determine optimal reaction conditions .

  • Kinetic Parameter Determination: Conduct experiments with varying substrate concentrations to determine fundamental kinetic parameters:

    • For DHS/PHS: Generate Michaelis-Menten plots to determine Km and Vmax

    • For acyl-CoA: Apply allosteric sigmoidal models to determine K0.5, Vmax, and Hill coefficient

  • Inhibitor Studies: Evaluate potential inhibitors using competitive, non-competitive, and uncompetitive inhibition models to understand binding mechanisms.

  • Temperature and pH Dependence: Assess enzymatic activity across temperature and pH ranges to identify optimal conditions and extract thermodynamic parameters.

  • Data Analysis and Modeling: Apply appropriate mathematical models (Michaelis-Menten, allosteric sigmoidal, etc.) to fit experimental data and extract kinetic parameters .

ParameterDHS SubstrateC26-CoA Substrate
Kinetic ModelMichaelis-MentenAllosteric Sigmoidal
Key ParametersKm, VmaxK0.5, Vmax, Hill coefficient
Concentration Range0-200 μM0-200 μM
Optimal Assay pH7.0-7.57.0-7.5
Temperature30°C30°C
Detection MethodDTNB colorimetric assayDTNB colorimetric assay

When interpreting results, researchers should consider that the Lac1-Lip1 complex exhibits much higher enzymatic activity compared to the Lag1-Lip1 complex, and that the activity of Lac1 alone is undetectable, highlighting the essential role of Lip1 in enzyme function .

What techniques are used to analyze lac1 mutations and their effects on drug resistance?

Researchers employ a comprehensive suite of techniques to analyze lac1 mutations and their effects on drug resistance:

  • Site-Directed Mutagenesis: Generate specific mutations in the lac1 gene, targeting conserved residues such as His255/His256 in the Lag1p motif, or residues involved in substrate binding and catalysis . This approach allows for precise investigation of structure-function relationships.

  • Drug Sensitivity Assays: Determine minimum inhibitory concentrations (MICs) or perform growth inhibition assays using various drugs (particularly doxorubicin) on wild-type versus mutant strains to quantify differences in drug sensitivity .

  • Drug Accumulation Studies: Leverage the natural fluorescence of compounds like doxorubicin to measure intracellular drug accumulation in wild-type versus mutant cells using fluorescence microscopy or flow cytometry .

  • Complementation Analysis: Introduce wild-type or mutant lac1 genes into lac1-deficient strains to assess which mutations can rescue the drug-sensitive phenotype, providing insights into functional domains .

  • Lipidomic Analysis: Use mass spectrometry to profile ceramide species and other sphingolipids in wild-type versus mutant cells, correlating specific lipid changes with altered drug sensitivity .

  • V-ATPase Activity Measurements: Assess vacuolar acidification using pH-sensitive dyes or probes to determine how lac1 mutations affect V-ATPase function, which is linked to drug sensitivity .

  • Gene Expression Analysis: Employ RT-PCR or RNA-seq to examine how lac1 mutations affect the expression of genes involved in drug resistance, stress response, and lipid metabolism.

  • Protein Localization Studies: Use fluorescently tagged Lac1 variants to determine if mutations affect protein localization, potentially explaining functional defects.

For experimental design, researchers should:

  • Include appropriate controls (wild-type, known drug-resistant, and hypersensitive strains)

  • Test multiple drugs with different mechanisms of action

  • Perform dose-response experiments rather than single-concentration assessments

  • Correlate drug sensitivity with biochemical parameters (enzyme activity, ceramide levels)

  • Consider genetic background effects that might influence phenotypic outcomes

How can structural information about lac1 guide inhibitor design for research applications?

The detailed structural information about lac1 provides a valuable foundation for rational inhibitor design that can advance research into ceramide synthesis and drug resistance:

  • Targeting the Catalytic Site: The hydrophilic cavity within the TLC domain contains four highly conserved charged residues (His255, His256, Asp283, and Asp286) that are critical for activity . Small molecules designed to interact with these residues could effectively inhibit enzyme function. The proximity of these residues to the thioester bond of the acyl-CoA substrate suggests that transition state analogs might be particularly effective inhibitors.

  • Substrate Binding Site Mimics: The structural data showing how C26-CoA binds within the cavity can guide the design of competitive inhibitors that mimic either the acyl-CoA or sphingoid base substrates . These could include non-hydrolyzable acyl-CoA analogs or modified sphingoid bases that bind but cannot undergo the acylation reaction.

  • Allosteric Modulators: The allosteric sigmoidal kinetics observed with varying C26-CoA concentrations suggests the presence of regulatory binding sites . Targeting these sites with small molecules could modulate enzyme activity without completely blocking the active site.

  • Disrupting Lac1-Lip1 Interaction: Since Lip1 is essential for Lac1 activity, compounds that interfere with the Lac1-Lip1 interaction could serve as effective inhibitors . This approach would require detailed knowledge of the protein-protein interaction interface.

  • Membrane-Targeted Approaches: Given that the enzymatic reaction occurs within the membrane, lipophilic compounds that can access the transmembrane regions of Lac1 might offer unique inhibitory mechanisms not available to more hydrophilic inhibitors .

For research applications, these inhibitors would enable:

  • Temporal control over ceramide synthesis in living cells

  • Investigation of ceramide-dependent processes

  • Studies on drug resistance mechanisms

  • Comparative analysis across different fungal species

  • Potential development of antifungal strategies targeting pathogenic fungi

When designing inhibitors, researchers should consider specificity (to avoid off-target effects), cell permeability (to ensure access to the target), and stability in cellular environments. Computational approaches such as molecular docking and virtual screening can accelerate the identification of promising candidate inhibitors based on the structural information available.

How conserved is lac1 across fungal species and what are the implications for research?

The lac1 gene and its function in ceramide synthesis exhibit remarkable conservation across fungal species, with significant implications for both basic research and potential therapeutic applications:

In S. cerevisiae, the Lag1 and Lac1 proteins function as ceramide synthases, catalyzing the N-acylation of sphingoid bases with acyl-CoA to generate ceramides . Similarly, in S. pombe, lac1 performs an analogous function. This functional conservation extends to the protein level, where the TLC domain and particularly the Lag1p motif containing the catalytic His255, His256, Asp283, and Asp286 residues are highly conserved .

The conservation extends beyond fungi to higher eukaryotes, where ceramide synthases (CerS1-6 in mammals) perform similar functions but with different substrate specificities . This evolutionary conservation highlights the fundamental importance of ceramide synthesis in eukaryotic cell biology.

The implications for research are substantial:

  • Model System Utility: S. pombe and S. cerevisiae serve as excellent model systems for studying the fundamental aspects of ceramide synthesis with findings potentially applicable across species .

  • Antifungal Development: The conservation of lac1 across pathogenic fungi, including Candida albicans, suggests that targeting ceramide synthesis could be a viable strategy for developing broad-spectrum antifungal agents .

  • Comparative Biochemistry: Differences in substrate specificity, regulation, and complex formation across species provide insights into the evolution of sphingolipid metabolism and its adaptation to different cellular environments.

  • Translational Research: Understanding how lac1 contributes to drug resistance in fungi may inform strategies to overcome similar resistance mechanisms in human cancer cells, given the conservation of these pathways .

  • Structural Biology: The conserved structural elements identified in fungal Lac1 can guide studies of mammalian ceramide synthases, which have been more challenging to characterize structurally.

Despite this conservation, it's important to note species-specific differences in regulation, substrate preference, and interaction partners. For instance, while both S. cerevisiae and S. pombe utilize Lip1 as a regulatory subunit, the enzymatic activities of their respective complexes differ significantly, with the Lac1-Lip1 complex showing much higher activity than the Lag1-Lip1 complex in reconstituted systems .

How do the structures and functions of ceramide synthases differ between fungi and mammals?

Ceramide synthases in fungi and mammals share core functional mechanisms but exhibit notable structural and functional differences that reflect their evolutionary divergence and adaptation to different biological contexts:

Structural Organization:
In fungi like S. pombe, ceramide synthase activity is provided by the Lac1-Lip1 or Lag1-Lip1 complexes. Lac1/Lag1 contains eight transmembrane domains (TM1-TM8), with the TLC domain (TM3-TM8) forming the catalytic core and a hydrophilic cavity housing the active site . In mammals, six distinct ceramide synthases (CerS1-6) have been identified, each with a TLC domain similar to fungal enzymes but with additional regulatory domains and modifications that affect substrate specificity and regulation .

Substrate Specificity:
Fungal ceramide synthases typically utilize very long-chain fatty acids (C26-CoA in S. cerevisiae) and either dihydrosphingosine (DHS) or phytosphingosine (PHS) as substrates . In contrast, mammalian CerS enzymes show distinct acyl-CoA chain length preferences: CerS1 prefers C18-CoA, CerS2 utilizes C20-C26-CoA, CerS3 uses C18-C24-CoA, CerS4 prefers C18-C20-CoA, CerS5 utilizes C16-CoA, and CerS6 prefers C14-C16-CoA . This diversification allows mammals to generate a complex sphingolipid repertoire with distinct functions.

Regulatory Mechanisms:
In fungi, the Lip1 regulatory subunit is essential for enzyme activity, as demonstrated by the lack of activity in purified Lac1 alone . Mammalian ceramide synthases appear to function without analogous regulatory subunits, instead employing various post-translational modifications and protein-protein interactions for regulation. Additionally, the allosteric regulation by acyl-CoA observed in fungal enzymes may differ in mammalian counterparts .

Physiological Roles:
While fungal ceramide synthases mainly contribute to membrane structure and stress responses including drug resistance , mammalian CerS enzymes have evolved more diverse roles in development, tissue homeostasis, and disease processes including cancer, neurodegeneration, and metabolic disorders.

FeatureFungal Ceramide SynthasesMammalian Ceramide Synthases
Number of IsoformsTypically 1-2 (Lac1, Lag1)Six isoforms (CerS1-6)
Regulatory SubunitRequires Lip1No direct Lip1 equivalent
Acyl-CoA PreferencePrimarily very long-chain (C26)Isoform-specific (C14-C26)
Catalytic ResiduesHis255, His256, Asp283, Asp286Conserved histidine and aspartate residues
Gene RegulationLimited tissue-specificityTissue-specific expression patterns
Disease AssociationDrug resistance in pathogenic fungiCancer, neurodegeneration, metabolic disorders

These differences highlight the evolutionary diversification of ceramide synthases to meet the more complex needs of multicellular organisms while maintaining the core catalytic mechanism.

How can lac1 research inform strategies to overcome drug resistance in pathogenic fungi?

Research on lac1 provides several promising avenues for developing strategies to overcome drug resistance in pathogenic fungi such as Candida albicans:

The discovery that lac1 mutations increase sensitivity to drugs like doxorubicin by promoting increased drug accumulation in cells offers a potential vulnerability that could be exploited . Given that the lac1 gene is conserved across various pathogenic fungi, targeting ceramide synthesis could serve as a broadly applicable approach to combat drug resistance.

Several strategic approaches emerge from lac1 research:

  • Direct Inhibition of Ceramide Synthase: Developing small molecule inhibitors that target the conserved catalytic residues (His255, His256, Asp283, Asp286) of fungal ceramide synthases could sensitize resistant strains to existing antifungal drugs . These inhibitors would need to be selective for fungal enzymes over mammalian ceramide synthases to minimize toxicity.

  • Targeting Regulatory Interactions: Disrupting the interaction between Lac1 and its essential regulatory subunit Lip1 could inhibit ceramide synthase activity specifically in fungi, as this regulatory mechanism appears distinct from mammalian systems .

  • V-ATPase Modulation: Since lac1 mutations affect V-ATPase function, and this appears linked to drug sensitivity, compounds that selectively inhibit fungal V-ATPases could synergize with existing antifungals .

  • Combination Therapy Approaches: Using ceramide synthase inhibitors in combination with traditional antifungals could enhance efficacy and prevent resistance development. This approach is supported by the observation that altered ceramide synthesis affects sensitivity to multiple drugs, suggesting a broad-spectrum sensitization effect .

  • Sphingolipid Pathway Targeting: Beyond direct inhibition of lac1, targeting other enzymes in the sphingolipid biosynthetic pathway could alter ceramide levels and distributions, potentially affecting drug resistance.

These approaches are particularly promising for addressing fluconazole resistance in Candida albicans, which presents a significant clinical challenge, especially in immunocompromised patients such as those with AIDS or undergoing chemotherapy . By manipulating ceramide synthesis pathways, it may be possible to restore drug sensitivity to multidrug-resistant (MDR) fungal strains, enhancing the efficacy of existing antifungal therapies.

The translational potential of this research is significant, offering new strategies to combat the growing problem of antifungal resistance through targeting conserved cellular processes that influence drug accumulation and toxicity in fungal pathogens.

What are the potential applications of recombinant Sphingosine N-acyltransferase lac1 in biochemical research?

Recombinant Sphingosine N-acyltransferase lac1, particularly in complex with its regulatory subunit Lip1, offers numerous valuable applications in biochemical research:

  • Enzyme Mechanism Studies: Purified recombinant Lac1-Lip1 complex serves as an excellent model system for investigating the catalytic mechanism of ceramide synthesis. The ability to introduce specific mutations and measure their effects on activity provides insights into the roles of conserved residues and structural elements . This can advance our fundamental understanding of acyltransferase reactions within membranes.

  • Inhibitor Screening and Development: The recombinant enzyme provides a platform for high-throughput screening of potential inhibitors that could be developed into research tools or therapeutic agents. The colorimetric DTNB assay for measuring CoA-SH release offers a convenient readout for such screening efforts .

  • Substrate Specificity Analysis: By testing various acyl-CoA donors and sphingoid base acceptors with the purified enzyme, researchers can map the substrate preferences of lac1 and compare them with other ceramide synthases. This information is valuable for understanding the evolutionary diversification of these enzymes and for designing substrate analogs .

  • Structural Biology Platforms: The successful purification and structural characterization of the Lac1-Lip1 complex provides a template for similar studies with other ceramide synthases, including the more complex mammalian enzymes that have been challenging to purify in active form .

  • Synthetic Biology Applications: Recombinant lac1 could be employed in enzymatic synthesis of specific ceramide species that are difficult to produce by chemical methods. This could provide access to rare or modified ceramides for studying their biological functions.

  • Reconstitution Systems: Incorporating the recombinant enzyme into liposomes or nanodiscs allows for controlled studies of how membrane composition affects enzyme activity, providing insights into the lipid environment requirements for optimal function.

  • Antibody Development: Purified recombinant lac1 can be used to generate specific antibodies for detecting and studying the endogenous protein in various contexts, facilitating localization and expression studies.

  • Drug Resistance Models: Recombinant systems expressing wild-type or mutant lac1 variants provide controlled platforms for studying how ceramide synthesis affects drug sensitivity and resistance mechanisms .

By providing access to a well-characterized enzyme involved in a fundamental lipid biosynthetic pathway, recombinant Sphingosine N-acyltransferase lac1 enables diverse research applications that advance our understanding of sphingolipid metabolism and its roles in normal physiology and disease states.

What are the key unresolved questions in lac1 research?

Despite significant advances in understanding Sphingosine N-acyltransferase lac1, several key questions remain unresolved that warrant further investigation:

  • Precise Catalytic Mechanism: While the conserved His255, His256, Asp283, and Asp286 residues are clearly essential for catalysis, the exact chemical mechanism of the N-acyltransferase reaction, including the roles of each residue in substrate binding, activation, and catalysis, remains to be fully elucidated .

  • Regulatory Networks: How is lac1 expression and activity regulated in response to various cellular stresses, particularly drug exposure? The transcriptional, post-transcriptional, and post-translational regulatory mechanisms controlling lac1 function are not completely understood .

  • Membrane Environment Effects: How do specific membrane lipids and the local membrane environment influence lac1 activity and substrate accessibility? The enzyme functions within the membrane, suggesting that membrane composition could significantly impact its activity .

  • Trafficking and Localization: What determines the precise subcellular localization of lac1, and does this localization change under different conditions? The spatial regulation of ceramide synthesis may have important functional implications.

  • Relationship with V-ATPase: While mutations in lac1 affect V-ATPase function and drug sensitivity, the molecular mechanisms linking ceramide synthesis to V-ATPase assembly or activity remain unclear and require further investigation .

  • Substrate Channeling: How are the products of lac1 (ceramides) channeled to downstream enzymes in the sphingolipid biosynthetic pathway? The coordination of these sequential enzymatic reactions within the membrane is not fully understood.

  • Evolutionary Adaptations: What selective pressures drove the diversification of ceramide synthases across species, and how do these relate to differences in substrate specificity and regulation? Comparative studies across diverse fungi could provide insights.

  • Therapeutic Targeting: Can lac1 be selectively targeted in pathogenic fungi without affecting host ceramide synthesis? The development of highly selective inhibitors remains challenging due to conservation of key structural features .

  • Role in Non-Canonical Pathways: Beyond ceramide synthesis, does lac1 participate in other cellular processes or interact with unexpected partners that contribute to its effects on drug resistance and cellular physiology?

  • Structural Dynamics: How does the Lac1-Lip1 complex change conformation during the catalytic cycle, and what are the dynamic aspects of substrate binding and product release? Current structural data provides a static view that may not capture the full range of conformational states .

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, cell biology, and genetics, and will advance our understanding of sphingolipid metabolism and its roles in drug resistance and cellular homeostasis.

How might advances in lac1 research impact broader fields of study?

Advances in lac1 research have far-reaching implications that extend beyond sphingolipid biochemistry to impact multiple scientific and medical domains:

  • Antimicrobial Drug Development: The understanding that lac1 and ceramide synthesis influence drug sensitivity in pathogenic fungi offers new strategies for developing adjuvants or combination therapies to combat antifungal resistance . This is particularly significant given the increasing prevalence of drug-resistant fungal infections in clinical settings.

  • Cancer Therapeutics: The mechanisms by which alterations in ceramide synthesis affect drug accumulation and sensitivity in fungal cells may have parallels in cancer cells. Insights from lac1 research could inform approaches to overcome multidrug resistance in cancer, potentially enhancing the efficacy of chemotherapeutic agents like doxorubicin .

  • Membrane Biology: The detailed structural and functional analysis of lac1 contributes to our understanding of how integral membrane enzymes operate within lipid bilayers. This knowledge advances the broader field of membrane protein biology and informs studies of other membrane-embedded enzymes .

  • Synthetic Biology and Metabolic Engineering: As we gain a deeper understanding of lac1 and ceramide synthesis, opportunities emerge for engineering sphingolipid biosynthetic pathways to produce novel bioactive lipids or modify cellular properties for biotechnological applications.

  • Evolutionary Biology: Comparative studies of ceramide synthases across species provide insights into the evolution of lipid metabolism and how diversification of these enzymes has contributed to adaptation and speciation. The conservation of key structural features amid functional diversification offers a window into molecular evolution .

  • Systems Biology: Integration of lac1 function into broader networks of cellular processes, including stress responses, membrane trafficking, and drug detoxification, contributes to systems-level understanding of cellular physiology and adaptation.

  • Structural Biology Methods: The successful structural characterization of the Lac1-Lip1 complex advances methodologies for studying challenging membrane protein complexes, potentially benefiting structural studies of other multipass transmembrane proteins .

  • Drug Delivery Systems: Understanding how alterations in ceramide composition affect drug accumulation could inform the design of drug delivery systems that overcome cellular barriers to achieve better therapeutic efficacy.

  • Fungal Physiology: Beyond drug resistance, insights into lac1 function enhance our understanding of fundamental aspects of fungal cell biology, including membrane organization, stress responses, and environmental adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.