Recombinant Schizosaccharomyces pombe Sphingosine N-acyltransferase lag1 (lag1)

What is Sphingosine N-acyltransferase lag1 and what is its function in S. pombe?

Sphingosine N-acyltransferase lag1 (EC 2.3.1.24) is an enzyme encoded by the lag1 gene (ORF: SPAC1A6.09c) in Schizosaccharomyces pombe. The protein is also known as Longevity assurance factor 1 or Longevity assurance protein 1 . It is a 390-amino acid transmembrane protein that plays a crucial role in sphingolipid biosynthesis, specifically in the N-acylation of sphingoid bases to form ceramides. In S. pombe, as a model organism, lag1 functions are studied in relation to cell growth, membrane integrity, stress responses, and cellular aging processes. The protein contains multiple transmembrane domains as evidenced by its sequence featuring hydrophobic regions interspersed with charged residues .

How should recombinant lag1 protein be stored for optimal stability?

For optimal stability, recombinant lag1 protein should be stored in a Tris-based buffer containing 50% glycerol. The recommended storage temperature is -20°C for regular use, or -80°C for extended storage periods . To maintain protein integrity, it's advisable to avoid repeated freeze-thaw cycles, as these can cause protein denaturation and loss of activity. For ongoing experiments, working aliquots may be stored at 4°C for up to one week . The high glycerol concentration (50%) helps prevent freeze damage to the protein structure while providing stability during storage and handling.

What expression systems are commonly used for producing recombinant S. pombe lag1?

While the search results don't specifically detail expression systems for lag1, recombinant proteins from S. pombe are typically produced using several expression platforms:

For studying lag1 function, expression in its native host S. pombe using regulated promoters like urg1 may be particularly valuable, as it allows for rapid induction and tight control of expression .

What are the best promoter systems for controlled expression of lag1 in S. pombe?

The urg1 promoter system is particularly advantageous for controlled expression of genes like lag1 in S. pombe. Unlike the traditional thiamine-regulatable nmt1 promoter which requires more than 15 hours for full induction, the urg1 promoter responds rapidly to uracil addition, with maximal transcript levels achieved within 30 minutes . This rapid response makes it ideal for studying time-sensitive processes.

The regulation characteristics of different promoter systems in S. pombe can be compared as follows:

For lag1 expression, the urg1 promoter offers the advantage of rapid induction and repression, making it suitable for studying the immediate effects of lag1 expression on cellular processes .

How can lag1 function be analyzed through mitotic recombination assays in S. pombe?

S. pombe offers powerful systems for studying protein functions through mitotic recombination assays. To analyze lag1 function in relation to DNA damage repair or replication stress, researchers can utilize several established assays:

• Non-tandem repeat assays can be employed to study recombination at repetitive elements, which may be relevant for understanding lag1's role in genomic stability .

• The RTS1 replication fork barrier system allows for controlled study of replication fork stalling and restart, which might reveal interactions between sphingolipid metabolism (mediated by lag1) and DNA replication processes .

• Single-strand annealing (SSA) assays can be used to study specific repair pathways that might be influenced by membrane composition and therefore by lag1 activity .

These assays would typically involve creating strains with lag1 under controlled expression (using systems like urg1 promoter) or lag1 deletion mutants, then measuring recombination rates and patterns under various conditions.

What methods are effective for studying lag1 localization and trafficking in S. pombe cells?

To study lag1 localization and trafficking in S. pombe, researchers can employ the following approaches:

• N-terminal tagging of lag1 using fluorescent proteins like GFP or mCherry. The PCR-based gene targeting modules described for the urg1 promoter system can be adapted for this purpose, allowing both controlled expression and visualization .

• Immunofluorescence microscopy using antibodies against lag1 or epitope tags introduced into the protein sequence.

• Subcellular fractionation followed by Western blotting to detect lag1 in different cellular compartments.

• Time-lapse microscopy combined with the rapid induction capability of the urg1 promoter system to observe real-time changes in lag1 localization in response to various stimuli .

Each method provides complementary information about lag1's dynamic behavior within the cell, helping to elucidate its function in different cellular compartments.

How does lag1 activity influence sphingolipid homeostasis and stress responses in S. pombe?

The relationship between lag1 activity, sphingolipid homeostasis, and stress responses can be investigated through sophisticated approaches:

• Lipidomic analysis can be used to quantify changes in the sphingolipid profile when lag1 expression is modulated. This would involve:

  • Extracting cellular lipids under different lag1 expression conditions

  • Analyzing sphingolipid species using liquid chromatography-mass spectrometry (LC-MS)

  • Correlating sphingolipid changes with cellular phenotypes

• Transcriptomic analysis (RNA-seq) to identify genes differentially expressed in response to altered lag1 activity, potentially revealing stress response pathways affected by sphingolipid imbalance.

• Phenotypic assays measuring resistance to various stressors (oxidative, heat, osmotic) in wild-type versus lag1-modified strains.

These approaches would help establish how lag1-mediated sphingolipid metabolism integrates with cellular stress response networks in S. pombe.

What protein-protein interactions are critical for lag1 function in sphingolipid biosynthesis?

Understanding lag1's protein-protein interaction network is crucial for fully characterizing its function. Advanced techniques to investigate these interactions include:

• Co-immunoprecipitation (Co-IP) followed by mass spectrometry to identify proteins that physically interact with lag1.

• Proximity labeling methods such as BioID or APEX, where a biotin ligase is fused to lag1, allowing biotinylation of nearby proteins that can then be purified and identified.

• Yeast two-hybrid screening specifically optimized for membrane proteins to identify interaction partners.

• Genetic interaction screens to identify genes that show synthetic lethality or suppression with lag1 mutations.

A comprehensive protein interaction map would reveal how lag1 functions within larger protein complexes and might identify novel regulatory mechanisms controlling sphingolipid biosynthesis.

How can structural analyses of lag1 inform the development of specific modulators of its activity?

Structural studies of lag1 can provide insights for rational design of modulators:

• Homology modeling based on the known structures of related enzymes can predict the three-dimensional structure of lag1, highlighting the catalytic site and substrate-binding regions.

• Site-directed mutagenesis of predicted key residues (based on the amino acid sequence: MSNRKADEKHHMSSSSLTNDRSYIRNLSNRKTSISRKVPITRTLEDPSNFVAKDGTKLVQ APLFLLVWQKEICLSIIAICFACLLSPSLRPYAEPFIFLSYKQPDGSYGKGPKDACFPIF WVIVFTAFRVIVMDYVFRPFVLNWGVRNRKVIIRFCEQGYSFFYYLCFWFLGLYIYRSSN YWSNEEKLFEDYPQYYMSPLFKAYYLIQLGFWLQQILVLHLEQRRADHWQMFAHHIVTCA LIILSYGFNFLRVGNAILYIFDLSDYILSGGKmLKYLGFGKICDYLFGIFVASWVYSRHY LFSKILRVVVTNAPEIIGGFHLDVPNGYIFNKPIYIAFIILLFTLQLLIYIWFGMIVKVA YRVFSGEEATDSRSDDEGEDEEASSTNEDK) to validate their importance for catalytic activity.

• In vitro assays measuring lag1 activity in the presence of candidate modulators.

The transmembrane nature of lag1 presents challenges for structural determination, but computational approaches combined with targeted biochemical studies can still yield valuable insights for modulator development.

What are common challenges in studying membrane proteins like lag1 and how can they be overcome?

Membrane proteins present several research challenges:

For lag1 specifically, the urg1 promoter system might offer advantages by allowing rapid and controlled expression, potentially reducing toxicity issues that can occur with constitutive expression of membrane proteins .

How can researchers address reproducibility issues in lag1 functional studies?

To ensure reproducibility in lag1 functional studies:

• Standardize lag1 expression levels using well-characterized promoter systems like urg1, which allows precise control over induction timing and expression levels .

• Develop quantitative assays for lag1 enzymatic activity that can be performed under standardized conditions.

• Use multiple complementary approaches to validate findings, such as combining genetic, biochemical, and cell biological methods.

• Ensure proper storage and handling of recombinant lag1 protein, following recommended protocols (storage at -20°C or -80°C, avoiding repeated freeze-thaw cycles) .

• Document detailed experimental protocols, including strain backgrounds, growth conditions, and assay parameters, to facilitate replication by other researchers.

What strategies can overcome limitations in detecting lag1 activity in complex cellular systems?

Detecting lag1 activity in complex cellular environments presents several challenges. Innovative strategies include:

• Development of activity-based protein profiling (ABPP) probes that specifically label active lag1 enzyme.

• Creation of fluorescent or bioluminescent reporters that respond to changes in sphingolipid levels mediated by lag1 activity.

• Metabolic labeling with isotope-labeled precursors followed by mass spectrometry to track flux through the sphingolipid synthesis pathway.

• Single-cell analysis techniques to account for heterogeneity in lag1 expression and activity within a population.

• Coupling the urg1 promoter system's rapid induction capabilities with time-resolved measurements to capture transient changes in lag1 activity .

These approaches can provide more nuanced insights into lag1 function than traditional bulk biochemical assays.

How might genetic manipulation of lag1 using CRISPR-Cas9 advance our understanding of sphingolipid metabolism?

CRISPR-Cas9 technology offers precise genetic manipulation capabilities that could significantly advance lag1 research:

• Generation of point mutations in the endogenous lag1 gene to study structure-function relationships without overexpression artifacts.

• Creation of conditional lag1 alleles through insertion of degron tags or regulatable introns.

• Precise tagging of endogenous lag1 with fluorescent proteins or affinity tags at either terminus or internal sites.

• Simultaneous manipulation of lag1 and interacting partners to study genetic interactions and pathway relationships.

• Development of CRISPR interference (CRISPRi) or activation (CRISPRa) systems compatible with S. pombe to modulate lag1 expression without permanent genetic changes.

These approaches, potentially combined with the rapid regulation offered by systems like the urg1 promoter , would enable more sophisticated studies of lag1 function in its native context.

What implications does lag1 research in S. pombe have for understanding human ceramide synthases and associated diseases?

Research on lag1 in S. pombe has translational relevance for human health:

• S. pombe lag1 shares functional homology with human ceramide synthases (CerS1-6), which are implicated in various diseases including cancer, neurodegeneration, and metabolic disorders.

• The simplified sphingolipid metabolism in yeast makes it an excellent model for dissecting basic mechanisms that may be conserved in humans.

• Insights from lag1 studies can inform the development of therapeutic strategies targeting specific ceramide synthase isoforms in humans.

• S. pombe assays for mitotic recombination could be adapted to study how sphingolipid imbalances caused by lag1 dysfunction affect genome stability, which has implications for cancer research.

Comparative studies between yeast lag1 and human ceramide synthases could reveal both conserved mechanisms and species-specific adaptations in sphingolipid metabolism regulation.